KEGG   Mus musculus (mouse): 12168
Entry
12168             CDS       T01002                                 

Gene name
Bmpr2, 2610024H22Rik, AL117858, AW546137, BB189135, BM, BMP, BMP-, BMP-2, BMPR-2, BMPR-II, BMPRII, BRK-3, Gm20272
Definition
(RefSeq) bone morphogenetic protein receptor, type II (serine/threonine kinase)
  KO
K04671  bone morphogenetic protein receptor type-2 [EC:2.7.11.30]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04060  Cytokine-cytokine receptor interaction
mmu04350  TGF-beta signaling pathway
mmu04360  Axon guidance
mmu04390  Hippo signaling pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu05206  MicroRNAs in cancer
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    12168 (Bmpr2)
   04390 Hippo signaling pathway
    12168 (Bmpr2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    12168 (Bmpr2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    12168 (Bmpr2)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    12168 (Bmpr2)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    12168 (Bmpr2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    12168 (Bmpr2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    12168 (Bmpr2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     12168 (Bmpr2)
Protein kinases [BR:mmu01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   12168 (Bmpr2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Activin_recp APH Cadherin_C_2
Other DBs
NCBI-GeneID: 12168
NCBI-ProteinID: NP_031587
MGI: 1095407
Ensembl: ENSMUSG00000067336
Vega: OTTMUSG00000047258
UniProt: O35607 Q3UU71 Q3UG09 Q3UER5
Position
1; 1 C2
AA seq 1038 aa
MTSSLHRPFRVPWLLWAVLLVSTTAASQNQERLCAFKDPYQQDLGIGESRISHENGTILC
SKGSTCYGLWEKSKGDINLVKQGCWSHIGDPQECHYEECVVTTTPPSIQNGTYRFCCCST
DLCNVNFTENFPPPDTTPLSPPHSFNRDETIIIALASVSVLAVLIVALCFGYRMLTGDRK
QGLHSMNMMEAAAAEPSLDLDNLKLLELIGRGRYGAVYKGSLDERPVAVKVFSFANRQNF
INEKNIYRVPLMEHDNIARFIVGDERLTADGRMEYLLVMEYYPNGSLCKYLSLHTSDWVS
SCRLAHSVTRGLAYLHTELPRGDHYKPAISHRDLNSRNVLVKNDGACVISDFGLSMRLTG
NRLVRPGEEDNAAISEVGTIRYMAPEVLEGAVNLRDCESALKQVDMYALGLIYWEVFMRC
TDLFPGESVPDYQMAFQTEVGNHPTFEDMQVLVSREKQRPKFPEAWKENSLAVRSLKETI
EDCWDQDAEARLTAQCAEERMAELMMIWERNKSVSPTVNPMSTAMQNERNLSHNRRVPKI
GPYPDYSSSSYIEDSIHHTDSIVKNISSEHSMSSTPLTIGEKNRNSINYERQQAQARIPS
PETSVTSLSTNTTTTNTTGLTPSTGMTTISEMPYPDETHLHATNVAQSIGPTPVCLQLTE
EDLETNKLDPKEVDKNLKESSDENLMEHSLKQFSGPDPLSSTSSSLLYPLIKLAVEVTGQ
QDFTQAANGQACLIPDVPPAQIYPLPKQQNLPKRPTSLPLNTKNSTKEPRLKFGNKHKSN
LKQVETGVAKMNTINAAEPHVVTVTMNGVAGRSHNVNSHAATTQYANGAVPAGQAANIVA
HRSQEMLQNQFIGEDTRLNINSSPDEHEPLLRREQQAGHDEGVLDRLVDRRERPLEGGRT
NSNNNNSNPCSEQDILTQGVTSTAADPGPSKPRRAQRPNSLDLSATNILDGSSIQIGEST
QDGKSGSGEKIKRRVKTPYSLKRWRPSTWVISTEPLDCEVNNNGSDRAVHSKSSTAVYLA
EGGTATTTVSKDIGMNCL
NT seq 3117 nt   +upstreamnt  +downstreamnt
atgacttcctcgctgcatcggccctttcgggtgccctggctgctatgggccgtcctgctg
gtcagcactacggctgcttctcagaatcaagaacggctgtgtgcatttaaagatccatat
caacaagatcttgggataggtgagagtcgaatctctcatgaaaatgggacaatattatgt
tccaaagggagcacgtgttatggtctgtgggagaaatcaaaaggggacatcaatcttgtg
aaacaaggatgttggtctcacatcggtgatccccaagagtgccactatgaagagtgtgta
gtaactaccaccccaccctcaattcagaatggaacgtaccgcttttgctgctgtagtaca
gatttatgtaatgtcaactttactgagaactttccaccccctgacacaacaccactcagt
ccacctcattcatttaatcgagatgaaacgataatcattgctttggcatcagtttctgtg
ttagctgttttgatagtcgccttatgttttggatacagaatgttgacaggagaccggaaa
cagggtcttcacagcatgaacatgatggaggcggcagcagcagagccctcccttgacctg
gataacctgaagctgctggagctgattggacggggtcgatacggagcagtatataaaggt
tccttggatgagcgtccagttgctgtaaaagtattttcttttgcaaaccgtcagaatttt
ataaatgaaaaaaacatttacagagtgcctttgatggaacatgacaacattgctcgcttc
atagttggagacgagaggctcactgcagacggccgcatggagtatttgcttgtgatggag
tattatcccaatggatctctgtgcaaatatctgagtctccacacaagtgattgggtaagc
tcttgccgtctggctcattctgtgactagaggactggcttatcttcacacagaattacca
cgaggagatcattataaacccgcaatctcccaccgagatttaaacagcaggaatgtcctg
gtaaagaatgacggcgcgtgtgttatcagtgactttggtttatccatgaggctaactgga
aatcggctggtgcgcccaggggaagaagataatgcggctataagtgaggttggcacaatt
cgctatatggcaccagaagtgctagaaggagctgtgaacctgagggactgtgagtcagct
ctgaagcaagtggacatgtatgcgcttggactcatctactgggaggtgtttatgaggtgt
acagacctcttcccaggtgaatctgtaccagattaccagatggcttttcagacagaagtt
ggaaaccatcccacatttgaggatatgcaggttcttgtgtccagagagaagcagagaccc
aagttcccagaagcctggaaagaaaatagcctggcagtgaggtcactcaaggaaacaatt
gaagactgctgggaccaggatgcagaggctcggctcactgcacagtgtgctgaggagagg
atggctgaactcatgatgatatgggagagaaacaagtctgtgagcccaacggtcaaccca
atgtcaactgctatgcagaatgaacgcaacctgtcacataataggcgtgtgccaaaaatc
gggccttacccagattattcctcttcctcatatattgaagactctatccatcatactgac
agcattgtgaagaatatttcctctgagcattcgatgtccagcacaccattgacaatagga
gaaaagaatcgaaattcaattaattatgaacgacagcaagcacaagctcgaatccctagc
ccagaaacaagcgtcacaagcctgtccacaaacacaaccaccacaaacaccaccggcctc
actccaagtactggcatgaccactatatctgagatgccatacccagatgagacacatttg
cacgccacaaatgttgcacagtcaatcgggccaacccctgtctgcttacagctgacagaa
gaagacttggagactaataagctagatccaaaagaagttgataagaacctcaaggaaagc
tctgatgagaatctcatggagcattctctgaagcagttcagtgggccagacccattgagc
agtaccagttctagcttgctttatccactcataaagctcgcagtggaagtgactggacaa
caggacttcacacaggctgcaaatgggcaagcatgtttaattcctgatgttccacctgct
cagatctatcctctccctaagcaacagaaccttcctaagagacctactagtttgcctttg
aacaccaaaaattcaacaaaagaaccccggctaaaatttggcaacaagcacaaatcaaac
ttgaaacaagtagaaactggagttgccaagatgaatacaatcaatgcagcagagcctcat
gtggtgacagtaactatgaatggtgtggcaggtagaagccacaatgttaattcccatgct
gccacaacccagtatgccaatggcgcagtgccagctggccaggcagccaacatagtggca
cataggtcccaagaaatgctgcagaatcaatttattggtgaggataccaggctgaatatc
aattccagtcctgatgagcatgaacctttactgagacgagagcaacaggctggccatgat
gaaggggttctggatcgtttggtagataggagggaacggccattagaaggtggccgaaca
aattccaataacaacaacagcaatccatgttcagaacaagatatccttacacaaggtgtt
acaagcacagctgcagatcctgggccatcaaagcccagaagagcacagaggcccaattct
ctggatctttcagccacaaatatcctggatggcagcagtatacagataggtgagtcaaca
caagatggcaaatcaggatcaggtgaaaagatcaagagacgtgtgaaaactccatactct
cttaagcggtggcgcccgtccacctgggtcatctccaccgagccgctggactgtgaggtc
aacaacaatggcagtgacagggcagtccattctaaatctagcactgctgtgtaccttgca
gagggaggcactgccacgaccacagtgtctaaagatataggaatgaattgtctgtga

DBGET integrated database retrieval system