KEGG   Mus musculus (mouse): 12176Help
Entry
12176             CDS       T01002                                 

Gene name
Bnip3, Nip3
Definition
(RefSeq) BCL2/adenovirus E1B interacting protein 3
  KO
K15464  BCL2/adenovirus E1B 19 kDa protein-interacting protein 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04068  FoxO signaling pathway
mmu04137  Mitophagy - animal
mmu04140  Autophagy - animal
mmu05134  Legionellosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    12176 (Bnip3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    12176 (Bnip3)
   04137 Mitophagy - animal
    12176 (Bnip3)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    12176 (Bnip3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    12176 (Bnip3)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    12176 (Bnip3)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Mitophagy
   Cargo receptors
    12176 (Bnip3)
Transporters [BR:mmu02000]
 Other transporters
  Pores ion channels [TC:1]
   12176 (Bnip3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BNIP3
Motif
Other DBs
NCBI-GeneID: 12176
NCBI-ProteinID: NP_033890
MGI: 109326
Ensembl: ENSMUSG00000078566
Vega: OTTMUSG00000023046
UniProt: O55003
Position
7; 7 F4
AA seq 187 aa AA seqDB search
MSQSGEENLQGSWVELHFSNGNGSSVPASVSIYNGDMEKILLDAQHESGRSSSKSSHCDS
PPRSQTPQDTNRAEIDSHSFGEKNSTLSEEDYIERRREVESILKKNSDWIWDWSSRPENI
PPKEFLFKHPKRTATLSMRNTSVMKKGGIFSADFLKVFLPSLLLSHLLAIGLGIYIGRRL
TTSTSTF
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcagagcggggaggagaacctgcagggctcctgggtagaactgcacttcagcaat
ggcaatgggagcagcgttccagcctccgtctctatttataatggtgacatggaaaaaata
ctgttggatgcccagcatgaatctggacgaagtagctccaagagttctcactgtgacagc
ccacctcgctcccagacaccacaagataccaacagagctgaaatagacagccacagcttt
ggcgagaaaaacagcactctgtctgaggaagattatattgagagaagaagagaagttgaa
agtatcctgaagaaaaactcagattggatatgggattggtcaagtcgaccagaaaatatt
ccccccaaggagttcctttttaaacacccgaagcgcacagctactctcagcatgagaaac
acaagcgttatgaagaaagggggaattttctcagcagactttctgaaggttttccttcca
tctctgttactgtctcatctgctggccattggcttggggatctacattggaaggcgtctg
acaacttccactagcaccttctga

DBGET integrated database retrieval system