KEGG   Mus musculus (mouse): 12183
Entry
12183             CDS       T01002                                 

Gene name
Bpgm, AI323730, AL022789, C86192
Definition
(RefSeq) 2,3-bisphosphoglycerate mutase
  KO
K01837  bisphosphoglycerate/phosphoglycerate mutase [EC:5.4.2.4 5.4.2.11]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00010  Glycolysis / Gluconeogenesis
mmu00260  Glycine, serine and threonine metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    12183 (Bpgm)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    12183 (Bpgm)
Enzymes [BR:mmu01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.4  bisphosphoglycerate mutase
     12183 (Bpgm)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     12183 (Bpgm)
SSDB
Motif
Pfam: His_Phos_1 Exc
Other DBs
NCBI-GeneID: 12183
NCBI-ProteinID: NP_031589
MGI: 1098242
Ensembl: ENSMUSG00000038871
Vega: OTTMUSG00000014784
UniProt: P15327
Position
6; 6 B1
AA seq 259 aa
MSKHKLIILRHGEGQWNKENRFCSWVDQKLNNDGLEEARNCGRQLKALNFEFDLVFTSIL
NRSIHTAWLILEELGQEWVPVESSWRLNERHYGALIGLNREKMALNHGEEQVRLWRRSYN
VTPPPIEESHPYFHEIYSDRRYKVCDVPLDQLPRSESLKDVLERLLPYWKERIAPEILKG
KSILISAHGNSSRALLKHLEGISDEDIINITLPTGVPILLELDENLRAVGPHQFLGNQEA
IQAAIKKVDDQGKVKQGKQ
NT seq 780 nt   +upstreamnt  +downstreamnt
atgtccaagcacaaacttattatactaagacatggagagggccaatggaataaggagaac
cgattctgtagttgggtggaccagaaacttaacaacgacggactggaggaggctcggaac
tgtgggaggcagctcaaagctctcaacttcgagtttgatcttgtcttcacatccatcctt
aacaggtccattcacacagcctggctgatcctggaagagctggggcaggagtgggtgcct
gtggagagctcctggcgtctgaatgagcgtcactatggagccttgattggcctcaacagg
gagaaaatggctttgaatcatggtgaagagcaggtaaggctctggaggagaagctacaac
gtgaccccacctcctatagaggagtctcatccctacttccacgagatctacagtgaccgg
aggtacaaagtgtgcgatgtgcccttggatcaactgccacgttcagaaagcttgaaggat
gttctggagagacttcttccctactggaaggaaaggattgctccggaaatcttaaagggc
aaaagcattctgatatctgctcacgggaatagcagtagagctctcctgaaacatctggaa
ggtatctcagacgaggatattatcaacatcactctgcccactggagttccgattctgctg
gagttggatgagaacctgcgtgccgttgggcctcaccagttcctgggcaaccaggaggcc
atccaggcagccattaagaaagtggatgatcaagggaaagtgaaacaaggcaaacaataa

DBGET integrated database retrieval system