KEGG   Mus musculus (mouse): 12189
Entry
12189             CDS       T01002                                 

Gene name
Brca1
Definition
(RefSeq) breast cancer 1, early onset
  KO
K10605  breast cancer type 1 susceptibility protein [EC:2.3.2.27]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01524  Platinum drug resistance
mmu03440  Homologous recombination
mmu03460  Fanconi anemia pathway
mmu04120  Ubiquitin mediated proteolysis
mmu04151  PI3K-Akt signaling pathway
mmu05206  MicroRNAs in cancer
mmu05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    12189 (Brca1)
  09124 Replication and repair
   03440 Homologous recombination
    12189 (Brca1)
   03460 Fanconi anemia pathway
    12189 (Brca1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    12189 (Brca1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    12189 (Brca1)
  09162 Cancer: specific types
   05224 Breast cancer
    12189 (Brca1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    12189 (Brca1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    12189 (Brca1)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    12189 (Brca1)
   03036 Chromosome and associated proteins [BR:mmu03036]
    12189 (Brca1)
   03400 DNA repair and recombination proteins [BR:mmu03400]
    12189 (Brca1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     12189 (Brca1)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     12189 (Brca1)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    12189 (Brca1)
  Multi subunit Ring-finger type E3
   BRCC complex
    12189 (Brca1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Regulators of centriole replication
     12189 (Brca1)
DNA repair and recombination proteins [BR:mmu03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    BRCA1-core complex
     12189 (Brca1)
    BRCA1-A complex
     12189 (Brca1)
    BRCA1-B complex
     12189 (Brca1)
    BRCA1-C complex
     12189 (Brca1)
    BRCA complex
     12189 (Brca1)
   FA (Fanconi anemia) pathway
    Downstream FA components
     12189 (Brca1)
SSDB
Motif
Pfam: BRCT_assoc BRCT zf-C3HC4 zf-C3HC4_2 BRCT_2 zf-C3HC4_4 zf-C3HC4_3 zf-RING_UBOX zf-RING_2 zf-RING_5 zf-Nse zf-RING_6 zf-ANAPC11 Prok-RING_4 zf-RING_10 zf-rbx1 Baculo_IE-1
Other DBs
NCBI-GeneID: 12189
NCBI-ProteinID: NP_033894
MGI: 104537
Ensembl: ENSMUSG00000017146
Vega: OTTMUSG00000002870
UniProt: P48754 Q6NV63
Position
11 65.18 cM; 11 D
AA seq 1812 aa
MDLSAVQIQEVQNVLHAMQKILECPICLELIKEPVSTKCDHIFCKFCMLKLLNQKKGPSQ
CPLCKNEITKRSLQGSTRFSQLAEELLRIMAAFELDTGMQLTNGFSFSKKRNNSCERLNE
EASIIQSVGYRNRVRRLPQVEPGNATLKDSLGVQLSNLGIVRSVKKNRQTQPRKKSVYIE
LDSDSSEETVTKPGDCSVRDQELLQTAPQEAGDEGKLHSAEEAACEFSEGIRNIEHHQCS
DDLNPTENHATERHPEKCQSISISNVCVEPCGTDAHASSLQPETSSLLLIEDRMNAEKAE
FCNKSKQPGIAVSQQSRWAASKGTCNDRQVPSTGEKVGPNADSLSDREKWTHPQSLCPEN
SGATTDVPWITLNSSVQKVNEWFSRTGEMLTSDSASARRHESNAEAAVVLEVSNEVDGGF
SSSRKTDLVTPDPHHTLMCKSGRDFSKPVEDNISDKIFGKSYQRKGSRPHLNHVTEIIGT
FITEPQITQEQPFTNKLKRKRSTSLQPEDFIKKADSAGVQRTPDNINQGTDLMEPNEQAV
STTSNCQENKIAGSNLQKEKSAHPTESLRKEPASTAGAKSISNSVSDLEVELNVHSSKAP
KKNRLRRKSSIRCALPLEPISRNPSPPTCAELQIDSCGSSEETKKNHSNQQPAGHLREPQ
LIEDTEPAADAKKNEPNEHIRKRRASDAFPEEKLMNKAGLLTSCSSPRKSQGPVNPSPQR
TGTEQLETRQMSDSAKELGDRVLGGEPSGKTTDRSEESTSVSLVSDTDYDTQNSVSVLDA
HTVRYARTGSAQCMTQFVASENPKELVHGSNNAGSGTEGLKPPLRHALNLSQEKVEMEDS
ELDTQYLQNTFQVSKRQSFALFSKPRSPQKDCAHSVPSKELSPKVTAKGKQKERQGQEEF
EISHVQAVAATVGLPVPCQEGKLAADTMCDRGCRLCPSSHYRSGENGLSATGKSGISQNS
HFKQSVSPIRSSIKTDNRKPLTEGRFERHTSSTEMAVGNENILQSTVHTVSLNNRGNACQ
EAGSGSIHEVCSTGDSFPGQLGRNRGPKVNTVPPLDSMQPGVCQQSVPVSDKYLEIKKQE
GEAVCADFSPCLFSDHLEQSMSGKVFQVCSETPDDLLDDVEIQGHTSFGEGDIMERSAVF
NGSILRRESSRSPSPVTHASKSQSLHRASRKLESSEESDSTEDEDLPCFQHLLSRISNTP
ELTRCSSAVTQRMPEKAEGTQAPWKGSSSDCNNEVIMIEASQEHQFSEDPRCSGSMFSSQ
HSAAQGSTANANSQDSNFIPPSKQRSHQCGNEEAFLSDKELISDNEEMATCLEEDNDQEE
DSIIPDSEASGYESETNLSEDCSQSDILTTQQRATMKYNLIKLQQEMAHLEAVLEQRGNQ
PSGHSPSLLADPCALEDLPDLEPNMSGAAILTSKNINENPVSQNLKSACDDKFQLQHLEG
PTSGDDESGMGRPSPFKSPLAGSRGSAHGCSRHLQKRNSPSQEELLQPAGSEASSEPHNS
TGQSCLPRRELEGTPYLGSGISLFSSRDPESESPKEPAHIGTTPASTSALKIPQGQVAFR
SAAAAGADKAVVGIVSKIKPELTSSEERADRDISMVVSGLTPKEVMTVQKFAEKYRLTLT
DAITEETTHVIIKTDAEFVCERTLKYFLGIAGGKWIVSYSWVVRSIQERRLLNVHEFEVK
GDVVTGRNHQGPRRSRESREKLFKGLQVYCCEPFTNMPKDELERMLQLCGASVVKELPSL
THDTGAHLVVIVQPSAWTEDSNCPDIGQLCKARLVMWDWVLDSLSSYRCRDLDAYLVQNI
TCDSSEPQDSND
NT seq 5439 nt   +upstreamnt  +downstreamnt
atggatttatctgccgtccaaattcaagaagtacaaaatgtccttcatgctatgcagaaa
atcttagagtgtccgatctgtttggaactgatcaaagaacctgtttccacaaagtgtgac
cacatattttgcaaattttgtatgctgaaacttcttaaccagaagaaagggccttcacaa
tgtcctttgtgtaagaatgagataaccaaaaggagcctacagggaagcacaaggtttagt
cagcttgctgaagagctgctgagaataatggctgcttttgagcttgacacgggaatgcag
cttacaaatggttttagtttttcaaaaaagagaaataattcttgtgagcgtttgaatgag
gaggcgtcgatcatccagagcgtgggctaccggaaccgtgtcagaaggcttccccaggtc
gaacctggaaatgccaccttgaaggacagcctaggtgtccagctgtctaaccttggaatc
gtgagatcagtgaagaaaaacaggcagacccaacctcgaaagaaatctgtctacattgaa
ctagactctgattcttctgaagagacagtaactaagccaggtgattgcagtgtgagagac
caggaattgttacagaccgcccctcaagaagctggagatgaaggcaagctgcactctgca
gaagaggctgcttgtgagttttctgagggcataagaaacattgaacatcatcaatgcagt
gatgatttaaaccctactgagaatcatgcaactgaaaggcatccagaaaaatgtcagagt
atttctatttcaaatgtgtgtgtggagccatgtggcacagatgctcatgccagctcatta
cagcctgagaccagcagtttattgctcattgaagacagaatgaatgcagaaaaggctgaa
ttctgtaataaaagcaaacagcctggcatagcagtgagccagcagagcagatgggctgca
agtaaaggaacatgtaacgacaggcaggttcccagcactggggaaaaggtaggtccaaac
gctgactcccttagtgatagagagaagtggactcacccgcaaagtctgtgccctgagaat
tctggagctaccaccgatgttccttggataacactaaatagcagcgttcagaaagttaat
gagtggttttccagaactggtgaaatgttaacttctgacagcgcatctgccaggaggcac
gagtcaaatgctgaagcagctgttgtgttggaagtttcaaacgaagtggatgggggtttt
agttcttcaaggaaaacagacttagtaacccccgacccccatcatactttaatgtgtaaa
agtggaagagacttctccaaaccagtagaggataatatcagtgataaaatatttgggaaa
tcctatcagagaaagggaagccgccctcacctgaaccatgtgactgaaattataggcaca
tttattacagaaccacagataacacaagagcagcccttcacaaataaattaaaacgtaag
agaagtacatcccttcaacctgaggacttcatcaagaaagcagattcagcaggtgttcaa
aggactcctgacaacataaatcagggaactgacctaatggagccaaatgagcaagcagtg
agtactaccagtaactgtcaggagaacaaaatagcaggtagtaatctccagaaagagaaa
agcgctcatccaactgaatcattgagaaaggaacctgcttccacagcaggagccaaatct
ataagcaacagtgtaagtgatttggaggtagaattaaacgtccacagttcaaaagcacct
aagaaaaataggctgaggaggaagtcttctatcaggtgtgctcttccacttgaaccaatc
agtagaaatccaagcccacctacttgtgctgagcttcaaatcgatagttgtggtagcagt
gaagaaacaaagaaaaaccattccaaccaacagccagccgggcaccttagagagcctcaa
ctcatcgaagacactgaacctgcagcggatgccaagaagaacgagccaaatgaacacata
aggaagagacgtgccagcgatgctttcccagaagagaaattaatgaacaaagctggttta
ttaactagctgttcaagtcctagaaaatctcaagggcctgtcaatcccagccctcagaga
acaggaacagagcaacttgaaacacgccaaatgtctgacagtgccaaagaactcggggat
cgggtcctaggaggagagcccagtggcaaaaccactgaccgatctgaggagagcaccagc
gtatccttggtatctgacactgactacgacactcagaacagtgtctcagtcctggacgct
cacactgtcagatatgcaagaacaggatccgctcagtgtatgactcagtttgtagcaagc
gaaaaccccaaggaactcgtccatggctctaacaatgctgggagtggcacagagggtctc
aagccccccttgagacacgcgcttaacctcagtcaggagaaagtagaaatggaagacagt
gaacttgatactcagtatttgcagaatacatttcaagtttcaaagcgtcagtcatttgct
ttattttcaaaacctagaagtccccaaaaggactgtgctcactctgtgccctcaaaggaa
ctgagtccaaaggtgacagctaaaggtaaacaaaaagaacgtcagggacaggaagaattt
gaaatcagtcacgtacaagcagttgcggccacagtgggcttacctgtgccctgtcaagaa
ggtaagctagctgctgatacaatgtgtgatagaggttgtaggctttgtccatcatctcat
tacagaagcggggagaatggactcagcgccacaggtaaatcaggaatttcacaaaactca
cattttaaacaatcagtttctcccatcaggtcatctataaaaactgacaataggaaacct
ctgacagagggacgatttgagagacatacatcatcaactgagatggcggtgggaaatgag
aacattcttcagagtacagtgcacacagttagcctgaataacagaggaaatgcttgtcaa
gaagccggctcgggcagtattcatgaagtatgttccactggtgactccttcccaggacaa
ctaggtagaaacagagggcctaaggtgaacactgtgcctccattagatagtatgcagcct
ggtgtctgtcagcaaagtgttcctgtaagtgataagtatcttgaaataaaaaagcaggag
ggtgaggctgtctgtgcagacttctctccatgtctattctcagaccatcttgagcaatct
atgagtggtaaggtttttcaggtttgctctgagacacctgatgacctgctggatgatgtt
gaaatacagggacatactagctttggtgaaggtgacataatggagagatctgctgtcttt
aacggaagcatcctgagaagggagtccagtaggagccctagtcctgtaacccatgcatcg
aagtctcagagtctccacagagcgtctaggaaattagaatcgtcagaagagagcgactcc
actgaggatgaagatcttccctgcttccaacacttactgagcagaataagcaacacacct
gagcttaccagatgcagcagtgctgtgacacagcgtatgccagagaaagcggaggggacc
caagcaccatggaagggtagcagcagtgactgcaataatgaggtgatcatgatagaggca
tctcaggagcatcagtttagtgaggatccaagatgctctggcagcatgttctcttcacag
cacagtgctgcccaagggtcaactgcaaatgcaaactcccaggattccaattttattcca
ccttccaaacagaggagtcaccagtgtgggaatgaggaagctttcctaagtgacaaggaa
ttgatttcagataacgaggaaatggcaacttgcctagaagaggataatgaccaagaagag
gatagtataatcccagattcagaggcatccggatacgagagtgaaacaaacctttctgaa
gactgctcgcagagtgatattttaaccactcagcagcgggcgaccatgaagtataacctg
ataaagctgcagcaggaaatggctcacctggaagctgtgctggagcagcgtgggaaccag
ccttctggccactccccttccctcctagcggacccttgtgccctggaagacctgccagat
ctggaaccaaacatgtcaggagcagcaattttaacttcaaagaacattaatgagaatcct
gtaagccaaaatttgaagagcgcttgtgatgacaaattccaactacaacatctggagggt
cccaccagtggagatgacgagtcagggatgggaaggccttccccttttaaatctccgttg
gcaggcagtaggggctctgcacatggctgctctaggcatcttcaaaagagaaactccccc
tctcaggaggagctcctccagcctgctggatcagaggcgtcatctgagccacacaattca
acagggcagtcttgcctgccaaggcgagagctagaaggaaccccatacctgggatctgga
atcagccttttctctagtagagaccccgaatctgagtcccctaaagagccagcccacatt
ggcaccacaccagcttcaacctctgcactgaaaataccccaaggtcaagttgctttccgg
agtgcagctgctgctggtgctgataaagcagtggtaggaattgtgagcaagataaagccg
gaattgacatcttcagaagaaagagcggatagagacatatccatggtggtgtcaggcttg
acccccaaagaagtaatgaccgtgcaaaagtttgctgaaaaataccgcctcactttaact
gacgcaattactgaggagactacacatgtaattataaaaacagatgcggagtttgtgtgt
gagcggacactgaaatattttctgggcattgcaggaggaaagtggatagttagctattca
tgggtggtccggtctatccaagaaagaagacttctgaatgtgcatgaatttgaagtcaaa
ggagatgttgtgactggaagaaatcaccaaggtccaaggcgatccagagaatcccgggaa
aagctcttcaagggcctacaggtctattgttgtgagcccttcaccaacatgcccaaagat
gagctggagaggatgctgcagctgtgtggggcttccgtggtgaaggagcttccatcgctc
acccatgacacaggtgctcatctagttgtgatcgtgcagccaagcgcctggacagaagac
agcaactgcccagatattgggcagctgtgcaaggcacgtcttgtgatgtgggactgggtg
ttggacagtctatccagctaccggtgtcgggatctggatgcctacctggtacagaatatc
acctgtgacagtagtgagccacaagactccaatgattaa

DBGET integrated database retrieval system