KEGG   Mus musculus (mouse): 12211Help
Entry
12211             CDS       T01002                                 

Gene name
Birc6, A430032G04Rik, A430040A19Rik, AA501170, Bruce, D630005A10Rik, mKIAA1289
Definition
(RefSeq) baculoviral IAP repeat-containing 6
  KO
K10586  baculoviral IAP repeat-containing protein 6 (apollon) [EC:2.3.2.23]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04120  Ubiquitin mediated proteolysis
mmu04215  Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    12211 (Birc6)
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    12211 (Birc6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    12211 (Birc6)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.23  E2 ubiquitin-conjugating enzyme
     12211 (Birc6)
Ubiquitin system [BR:mmu04121]
 Ubiquitin-conjugating enzymes (E2)
  Ubiquitin-conjugating enzymes
   12211 (Birc6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BIRC6 UQ_con BIR UEV
Motif
Other DBs
NCBI-GeneID: 12211
NCBI-ProteinID: NP_031592
MGI: 1276108
Ensembl: ENSMUSG00000024073
Vega: OTTMUSG00000042370
UniProt: O88738 Q3UYZ6
Position
17; 17 E2
AA seq 4873 aa AA seqDB search
MVTGCGAAPPGTVTERLPSVIVLSAGRKMAAAAAEASGPSCSSAAAAAGAGAAGVSEWLV
LRDGCMRCDADGLHSLSYHPALNAILAVTSRGTIKVIDGTSGATLQASALSAKPGGQVKC
QYISAVDKVIFVDDYAVGCRKDLNGILLLDTALQTPVSKQDDVVQLELPVTEAQQLLSAC
IEKIDVSSTEGYDLFITQLKDGLKNTSHETAANHKVAKWATVTFHLPHHVLKSIASAIVN
ELKKINQNVAALPVASSVMDRLSYLLPSARPELGVGPGRSVDRALMYSEANRRETFTSWP
HVGYRWAQPDPMAQAGFYHQPASSGDDRAMCFTCSVCLVCWEPTDEPWSEHERHSPNCPF
VKGEHTQNVPLSVTLATSPAQLPSADGADRIACFGSGSCPQFLAAATKRGKICIWDVSKL
MKVHLKFEINAYDPAIVQQLILSGDPSSGVDSRRPTLAWLEDSSSCSDIPKLEGDSDDLL
EDSDSEEHSRSDSVTGHTSQKEAMEVSLDITALSILQQPEKLQWEIVANVLEDTVKDLEE
LGANPSLTNSKSEKTKEKHQEQHNIPFPCLLAGGLLTYKSPATSPISSNSHRSLDGLSRT
QGESISEQGSTDNESCTNSELNSPLVRRTLPVLLLYSIKESDEKAGKIFSQMNNIMSKSL
HDDGFTVPQIIEMELDNQEQLLLQDPPVTYIQQFADAAASLTSPDSEKWNSVFPKPGALV
QCLRLPKFAEEETLCIDSITPCADGIHLLVGLRTCSVESLSAINQVEALNNLNKLNSALC
NRRKGDLESNLAVVNGANISVIQHESPADVPEHLLIRPEQRNVVSGGYLVLYKMNYTTRI
VTLEEEPVKIQHIKDPQDTITSLILLPPDILDNREDDCEEPAEEMQLASKNGIEREKKSD
ISTLGHLVVTTQGGYVKVLDLSNFEILAKVEPPKKEGTEEQDTFVSVIYCSGTDRLCACT
KGGELHFLQIGGTCDDIDEADILVDGSLSKGIEPALEGSRPLSNPSSPGISGVELLVDQP
FTLEILTSLVELTRFETLTPRFSATVPPCWVEVQQEQQQRRHPQHLHQQHHGDAAQHTRT
WKLQTDSNSWDEHVFELVLPKACMVGHVDFKFVLNSNITSVPQIQVTLLKNKAPGLGKAN
ALNIEVEHNGNPSLVDLNEEMHHMDVEESQCLRLCPFLEDHKEDILCGPVWLASGLDLSG
HAGMLTLTSPKLVKGMAGGKYRSFLIHVKAVSDRGAADEMCSSGLRPVVRLPSLKQQGHK
GYSLASLLAKVAAGKEKSSNVKNENAGGTRKSENLRGCDLLQEVSVTIRRFKKTSICKER
VQRCAMLQFSEFHEKLLNTLCRRSDDGQVTEHAQSLVLDALCWLAGVHSNGSGSSKEGNE
CLLSKTRKCLSDIVRVCFFEAGRSIAHKCARFLALCISNGKCEPCQPGFGSVLLKALLDN
MCFLPAAATGGSVYWYFVLLNYVKDEDLAGCSTACAALLTAVSRQLQDRLTPLEALLQTR
YGLYSSPFDPVLFDLEMSGSSWKTVYSSSTAVQSDEIDLSDVLSGNGRVSSCTAAEGSFT
SLTGLLEVEPLHFTCVSTSDGTRIERDDASTFTVSSFGVPPAVGGLSSGTVGEASTALSS
AAQVALQSLSHAMASAEQQLQVLQEKQQQLLKLQQQKAKLEAKLHQTTAAAAAAASAAAA
AAAGPVHNAVPSNPVAAPGFFIHPSDVIPPTPKTTPLFMTPPLTPPNEAVSVVINAELAQ
LFPGSVIDPPAVNLAAQNKNSSKSRMNPLGSGLALAISHASHFLQPPPHQSIIIERMHSG
ARRFVTLDFGRPILLTDVLIPTCGDLASLSIDIWTLGEEVDGRRLVVATDISTHSLILHD
LIPPPVCRFMKITVIGRYGSTNARAKIPLGFYYGHSYILPWESELKLMHDPLRGEGESAS
QPEIDQHLAMMVALQEDIQCRYNLACHRLEALLQSIDLPPLNSANNAQYFLRKPDKAVEE
DSRVFSAYQDCIQLQLQLNLAHNAVQRLKVAIGASRKLLNETSGPEDLIQTSSTEQLRTI
VRYLLDTLLSLLHSSNGHSVPAVLQSTFHAQACEELFKHLCISGTPKIRLHTGLLLVQLC
GGERWWGQFLSNVLQELYNSEQLLIFPQDRVFMLLSCIGQRSLSNSGVLESLLNLLDNLL
SPLQPELSMHRRTEGVLDIPMISWVVMLVSRLLDYVATVEDEAAAAKKPLNGNQWSFINN
NLHTQNLNRSSKGGSSLDRLYSRKIRKQLVHHKQQLNLLKAKQKALVEQMEKEKIQSNKG
SSYKLLVEQAKLKQATSKHFKDLIRLRRTAEWSRSNLDTEVTTTKESPEIEPLPFTLAHD
RCISVVQKLVLFLLSMDFTCHADLLLFVCKVLARIANATRPTIHLCEIVNEPQLERLLLL
LVGTDFNRGDISWGGAWAQYSLTCMLQDILAGELLAPVAAEAMEECTVSEDVGATAGDSD
DSLQQSPAQLLETIDEPLTHEIAGTPPLSSLEKDKEIDLELLQDLMEVDIDPLDIDLEKD
PLAAKVFKPISSTWYDYWGADYGTYNYNPYIGGLGMPVAKPPSNTEKNGSQTVSVSVSQA
LDARLEVGLEQQAELMLKMMSTLEADSILQALTNTSPTFSQSPTGTDDSLLGNLQPANQN
SQLMIQLSSVPMLNVCFNKLFSMLQVHHVQLESLLQLWLTLSLNSSSSGNKENGADIFLY
NANRIPVISLNQASIASFLTVLAWYPNTLLRTWCLVLHSLTLMTNMQLNSGSSSSIGIQE
TTAHLLVSDPNLIHVLVKFLSGTSPHGTNQHSPQVGPTATQAMQEFLTRLQVHLSSTCPQ
IFSELLLKLIHILSTERGAFQTGQGPLDAQVKLLEFTLEQNFEVVSVSTISAVIESVTFL
VHHYITCSDKVMSRSGSDSSAGARACFGGLFANLIRPGDAKAVCGEMTRDQLMFDLLKLV
NILVQLPLSSNREYSARVSVTTNTTDSVSDEEKVSGGKDVNGSSASTPGSPACVADLVLA
NQQIMSQILSALGLCNSSAMAMIIGASGLHLTKHENFHGGLDAISVGDGLFTILTTLSKK
ASTVHMMLQPILTYMACGYMGRQGSLATCQLSEPLLWFILRVLDTSDALKAFHDMGGVQL
ICNNMVTSTRAIVNTARSMVSTIMKFLDSGPNKAVDSTLKTRILASEPDNAEGIHNFAPL
GTITSSSPTAQPAEVLLQATPPHRRARSAAWSYIFLPEEAWCDLTIHLPSAVLLKEIHIQ
PHLASLATCPSSVSVEVSADGVNMLPLSTPVVTSGLTYIKIQLVKAEVASAVCLRLHRPR
DASTLGLSQIKLLGLTAFGTTSSATVNNPFLPSEDQVSKTSIGWLRLLHHCLTHISDLEG
MMASAAAPTANLLQTCAALLMSPYCGMHSPNIEVVLVKIGLQSTRIGLKLIDILLRNCAA
SGSDPTDLNSPLLFGRLNGLSSDSTIDILYQLGTTQDPGTKDRIQALLKWVSDSAKMAAL
KRSGRMNYMCPSSSAVEYGLLMPSPSHLHCVAAILWHSYELLVEYDLPALLDRELFELLF
NWSMSLPCNVVLKKAVDSLLCSMCHIHPNYFSLLMGWMGIIPPPVQCHHRLSMTDDSKKQ
DLSSSLTDDSKNAQAPLSLTESHLATLASSSQSPEAIKQLLDSGLPSLLVRSLASFCFSH
ISYSESIAQSVDNSQDKLRRHHVPQHCNKMPITADLVAPILRFLTEVGNSHIMKDWLGGS
EVNPLWTALLFLLCHSGSTAGGHNLGAQQSSTRSASHSSATTTVLTTQQRTAIENATVAF
FLQCISCHPNNQKLMAQVLCELFQTAPQRGSLPTSGNISGFVRRLFLQLMLEDEKVTMFL
QSPCPLYKGRINATSHVIQHPMFGAGHKFRTLHLPVSTTLSDVLDRVSDTPSITAKLISE
QKDDKEKKNHEEKEKVKAENGFQDNYSVVVASGLKSQSKRAMASTPPRPPSRRGRTIPDK
IGSASSSADAASKIITVPVFHLFHRLLAGQPLPAEMTLAQLLTLLYDRKLPQGYRSIDLT
VKLGSKVITDPSLSKTDSFKRLHPEKDHGDLVGSCPEDEALTPSDECMDGVLDESLLETC
PIQSPLQVFAGMGGLALIAERLPMLYPEVIQQVSAPVIASTTQEKPKDSDQFEWVTIEQS
GELVYEAPETIAAEPPPVKSAVQATSPIPAHSLAAFGLFLRLPGYAEVLLKERKHAQCLL
RLVLGVTDDGEGSHILQSPSANVLPTLPFHVLRSLFSATPLTTDDGVLLRRMALEIGALH
LILVCLSALSHHAPRVPNSSLSQTEPQVSNSHNPTSAEEQQLYWAKGTGFGTGSTASGWD
VEQALTKQRLEEEHVTCLLQVLASYINPMSGAVNGEAQASPESRAQNSSALPSVLLELLS
QSCLIPAMSSYLRNDSVLDMARHVPLYRALLELLRAIASCTSMVPLLLPLSTENGEEEED
EQSECQTSVGTLLAKMKTCVDTYTNRLRSKRENVKAGVKPDAPDQEPEGLALLVPDIQRT
AEIVHAATANLRQANQEKKLGEYSKKVVMKPKPLSVLKSLEEKYVAVMKKLQFDTFEMVS
EDDDGKLGFKVNYHYMSQVKNANDANSAARARRLAQEAVTLSTSLPLSSSSSVFVRCDEE
RLDIMKVLITGPADTPYANGCFEFDVYFPQDYPSSPPLVNLETTGGHSVRFNPNLYNDGK
VCLSILNTWHGRPEEKWNPQTSSFLQVLVSVQSLILVAEPYFNEPGYERSRGTPSGTQSS
REYDGNIRQATVKWAMLEQIRNPSPCFKEVIHKHFYLKRIELMAQCEEWIADIQQYSSDK
RVGRTMSHHAAALKRHTAQLREELLKLPCPEGLDPDIEDASPVCRATAGAEDTLTHDHVN
PSSSKDLPSDFQL
NT seq 14622 nt NT seq  +upstreamnt  +downstreamnt
atggtgactggctgtggtgctgcacctcccgggactgtcactgagcggcttcccagtgtg
attgtgctgagcgcaggccggaagatggcggctgcggctgcggaggcctcgggcccgagc
tgctcctccgcggcggcggcggcaggggcgggggcggccggggtctccgagtggctggtg
ctgcgggatggctgcatgcgctgcgacgccgacgggctgcacagcctctcctaccacccg
gcgcttaacgccatcctggccgtcaccagccgcgggaccatcaaagtcatcgacggcacg
tccggggccacccttcaggcctcggcgctcagcgctaaaccaggtggacaggtgaaatgt
cagtatatttctgctgtggataaagtgatatttgtggatgattacgccgtgggctgtagg
aaggaccttaatgggatcttgttgctagacactgctctgcaaactccagtttcaaagcag
gacgatgtggttcagctggaacttcccgtcacagaggcacagcagctcttatcagcatgt
atagaaaagatagatgtttctagtacagagggttatgatttgttcatcacacagctcaaa
gatggtttaaaaaatacatctcatgaaactgcagcaaaccataaagttgctaagtgggcc
acagttacatttcatcttcctcatcacgtattgaagtctattgccagtgccattgtaaat
gaacttaagaaaataaatcaaaatgttgctgccttacctgtggcgtcctcagtgatggac
agattgtcttacctcttgcccagtgcacgtccagaacttggagttgggccaggccgttct
gtagacagggcattgatgtatagtgaagctaacagaagggagaccttcacttcgtggcct
catgttggctataggtgggcacagccagatcccatggctcaagctggattttatcaccag
cctgcttcatctggagatgatagagccatgtgttttacttgtagtgtttgcctcgtttgt
tgggagcctacggatgaaccttggtccgaacatgagagacactctcccaactgtcccttt
gtgaagggtgagcacacccagaatgtgcccttgtcagtcaccctggcaacgagtcctgcg
cagctcccttctgcagatggagctgacagaatagcttgctttgggtctgggagctgtcct
cagtttctagctgctgcaaccaaacgtgggaagatctgcatatgggacgtctccaaactc
atgaaggtgcacttgaagtttgaaattaatgcctatgacccagcaatcgtgcaacagctg
atcctatcaggagacccaagttcaggagttgattcaaggagacccactttggcatggctg
gaagactcttctagttgctcagacataccgaaactggaaggagacagtgatgatttgctg
gaggattcagacagtgaagagcattccagatcggattctgtgacagggcatacatcacag
aaggaagccatggaagtaagccttgatataacagctctcagcattctccagcagccagaa
aaactgcagtgggagattgtggctaatgtgcttgaagatactgttaaggatcttgaagaa
cttggggcaaacccctccctaacgaactctaagagtgaaaagacaaaggaaaagcaccag
gaacaacacaacattcccttcccctgtttattggctggaggtttattaacatataagtct
cctgctacctcacccattagtagtaattctcacaggtcactggatggtttaagcagaact
cagggcgaaagtatatcagaacaagggtcaactgacaatgaatcctgcacaaattcagag
ctgaattctcctctggtcaggaggactttacctgtgttacttctttatagtatcaaagaa
tctgatgagaaagcaggaaaaatcttttcacagatgaacaatatcatgagtaaaagtttg
cacgatgacggttttacagttcctcagattattgaaatggagctggacaaccaggagcag
ctgttgttacaggatccgcctgtgacttacatccagcagtttgcagatgcagccgccagc
ctcacttctccagattccgagaagtggaactctgtgttccccaagcctggggctttggtg
cagtgcttgaggctaccaaagtttgcagaggaggagactctttgtatagactctataact
ccttgtgctgatggaattcatttgttggtaggactgcggacatgctctgtggaatcattg
agtgcaataaatcaagtcgaggccttgaataatttaaataaattaaactctgcactatgt
aatagacgtaaaggtgatctggaatccaatcttgctgtagtgaatggtgcaaatatcagt
gtgatccaacatgagtcaccagcagatgtgccggagcatctgctcatccggccggagcag
aggaatgtcgtcagtggtggatatttagttctttacaagatgaactataccactcgaata
gtgactttagaagaggagcccgtgaaaatccaacatatcaaagatccccaggacacaatt
acctcgctcattttgcttccaccagatatactggataatcgagaggatgactgtgaggaa
cctgctgaggaaatgcagttagcctcaaagaatgggattgaaagagaaaaaaagtctgac
atttctacgcttggacacctggtagtaaccactcagggaggatacgtgaaagtattagac
ctttcaaacttcgaaattttggccaaagtggagcctcccaaaaaggagggcactgaagaa
caggatacatttgtttctgtcatttactgctcaggcacagacaggctgtgtgcgtgcacc
aaaggtggtgagcttcattttctccaaattggaggaacctgtgatgatattgatgaagct
gatattctggtagatggatccctttctaaaggaatagaaccagctctagaaggttccaga
cctttatcaaatccttcaagtcctggtatttcaggagttgagttattggtggaccagcct
ttcacacttgaaatcttgacgtctttagtagaactaactcgatttgaaacactgactcca
cgattttcagcaactgttcctccatgttgggtagaagttcagcaagaacagcagcaaaga
aggcacccgcagcatctgcaccagcagcaccacggcgatgctgctcagcacacccggacc
tggaaactgcagaccgacagcaacagctgggatgaacatgtgtttgaattggttctacct
aaagcctgtatggttggacatgtggacttcaaattcgttctgaactccaacatcaccagt
gtcccccagatacaagtgacactgctgaagaacaaagctccaggcctagggaaagccaat
gctcttaacattgaagtggaacataatgggaacccgtccctggttgatttgaatgaagaa
atgcaccacatggatgtagaggagtcacagtgtcttaggttatgtccattcttagaggat
cataaagaagacattctgtgtggcccagtatggcttgctagtggtctggacctatcaggt
catgctgggatgttgacgttgacaagccccaaacttgttaaaggtatggcaggagggaag
taccgttcatttttaattcatgtcaaagcagtgagtgaccgaggagcagcagatgagatg
tgcagcagtggcctgcgtcctgttgtgaggcttccatctcttaaacagcagggtcacaag
ggatactcactggcttctctcttggccaaagttgcagcaggcaaggaaaaatcatctaat
gttaaaaatgaaaatgcaggaggcacccgaaagtctgaaaacctgcggggttgtgattta
cttcaggaggtgtctgtcaccattcggaggtttaagaaaacctccatctgtaaggaaagg
gttcagcgttgcgccatgttacagttttcagaatttcatgagaagcttcttaacacgctt
tgtagacgatcagatgatgggcaggtcacagagcacgcccagagtcttgtgttggatgct
ctctgctggttagcaggagtccattcaaatggatctggcagctcaaaggaaggaaatgag
tgcctactttcaaaaacacggaaatgtctttccgatattgtccgtgtatgcttctttgag
gcaggacgaagtatagcccataaatgtgctcggtttctagccttgtgcattagtaatggc
aaatgcgagccctgtcagcctggatttggatcggttctattgaaggctttacttgataat
atgtgctttttaccagcagcagcaactggtggttctgtctactggtattttgtactgctg
aattatgttaaggacgaagacctggctggatgcagcacagcgtgtgcagccctacttacg
gctgtgtccagacagctgcaggacaggctaacgccgctggaggctctgcttcaaacaaga
tatggactgtacagctccccgtttgatccagttctctttgacttggagatgagcggctct
tcttggaaaactgtgtacagtagcagcactgctgtccagtcagatgaaatcgacttatca
gacgttctttcagggaatggaagagtcagcagttgcacggctgcggagggaagcttcaca
tctctcacggggcttctagaggttgaacctcttcactttacttgcgtgtcaaccagtgat
gggaccagaatagaaagggatgatgcaagtacgtttactgtgagttccttcggggttcct
cctgcagtaggtggcctatcatctggcacagttggggaagcctcgacagccctgagttca
gcagcccaggtagctttgcagtctctctctcatgcaatggcttcagccgagcaacagctg
caggtgctgcaagagaaacagcagcagcttttgaagcttcagcaacagaaagcaaagctg
gaagccaagctgcatcagacaacagcggcagcagcagcagctgcatcagcagcggcagca
gcagcagcaggtcctgttcacaatgcagtgccttccaacccagtggctgctcctggattc
ttcatccatccatctgatgttattccccccactccaaaaacaacaccactctttatgact
ccaccgctgactccgcccaacgaagctgtttctgttgtgattaatgctgagcttgcccag
cttttcccaggctcagtcattgatcctcccgcagtgaatcttgctgcacagaacaaaaac
tccagcaaatctagaatgaatccacttggttctggcctggcccttgcaatttctcatgcc
tcacattttcttcagccgccacctcaccagtccattattatagagcgaatgcattcagga
gccaggagatttgtcaccctggattttggaagacctatactgctgacagatgtactgatt
cctacttgtggagacttggcgtctttatcaattgacatatggacattaggggaagaagta
gatggaaggcgtttggttgtggcaactgatatcagtactcattcactaattcttcatgac
ttaatacctccacctgtatgcagattcatgaagataactgtcattggacgctatggaagc
acaaatgccagagcaaagatccccttgggattttactacgggcacagctatatcttacct
tgggaaagtgagctgaagttgatgcacgaccctctcagaggcgaaggagaatctgccagc
cagccagaaattgaccagcatttagcaatgatggttgctctacaagaagatatacagtgc
agatataacctagcctgtcatcgtctggaagctcttttgcagagtattgatcttcctccg
ctcaatagtgctaacaatgcacagtactttttgagaaaaccagacaaagcagtcgaggaa
gacagtagagttttttctgcttatcaagattgcattcagctacagcttcaattaaatctg
gctcataatgcagtgcagaggctcaaagtagccataggtgcaagtcggaagttgttgaat
gaaacatcaggtccagaagacctgattcagacgtcatccacagagcagttacgcaccatt
gtgagatacttactggatacactgctcagcctcctgcactcttccaatgggcattctgtt
cctgcagttttacagagtacctttcacgctcaggcctgtgaagaactgtttaaacacttg
tgcatcagtgggaccccaaagatacggttgcatactggcctgctccttgttcagctatgt
ggtggtgagagatggtggggccagtttctttctaacgttcttcaggaactgtataattca
gagcagcttctcatcttcccacaagatagggtctttatgttactctcctgcattggacag
cgatcacttagtaacagtggagtattggaaagtttactaaacctcttggacaatttattg
tcacctcttcagccagagttaagcatgcacagaaggacagaaggagtcctggacattccc
atgatcagttgggttgttatgctggtgtccaggttactggattatgtggccactgttgaa
gatgaagcagctgctgcaaagaaacctttgaatggtaaccaatggagttttattaacaat
aatctgcatactcagaacttaaatagatcctccaagggaggcagtagcctcgatagatta
tattccagaaaaatcagaaagcagcttgtccatcataagcagcaacttaacctactaaag
gcaaaacagaaggctttggtggaacagatggaaaaagaaaaaatacagagtaacaaaggc
tcatcatataaactgctagtagagcaagcaaaactgaagcaggcgacctccaagcatttt
aaggatttgattcgcttgcgccggacagcagaatggtctcgttctaatttagacactgaa
gttacaacaacaaaagagagccctgagattgagcctcttccatttactctggcccatgac
cgttgtatctcagtagtgcaaaagctcgtcctgtttcttctttccatggatttcacctgc
catgcagacctcttactgtttgtctgcaaggttcttgcacgcattgcaaatgcgaccagg
ccaactattcatctgtgtgaaattgtgaatgagccgcagttagaaagactgttattgctt
ctggttggaactgacttcaacagaggagacatctcttggggtggtgcctgggctcagtat
tctttaacctgtatgctgcaggacattctagcaggagaattgttggctccggtggctgca
gaagcgatggaagaatgcactgtgagtgaggatgttggtgcaacagctggcgactctgat
gactccctgcagcagtcccccgctcagctgctggaaaccatagatgaaccattgacacat
gagatagcaggtacgcctcctctctcttccttggaaaaagataaggaaattgaccttgag
ctacttcaagacctcatggaagttgacattgatcctttagatattgatctagaaaaggat
cctcttgcagccaaagtttttaagcctataagcagtacatggtatgactactggggtgct
gattatggtacctataattataatccttacattggaggcctggggatgcctgtagcaaaa
ccaccatcaaacacagagaagaatggatcccagactgtcagtgtttcggtgtctcaggct
ttagatgctcgtctagaagttggtcttgaacagcaagcagaacttatgttgaaaatgatg
tctactctggaagcagactccatcttacaagcattaacaaatacatctcctaccttttca
caatctccaactggaacagatgactcacttctggggaatttacagccagcaaaccagaac
agccagctcatgatacagctctcatctgtcccaatgttaaatgtttgtttcaataaactc
ttctccatgcttcaagtccatcatgttcagttggagtcacttcttcagttgtggctcaca
ttgagccttaattctagttcatcagggaacaaagagaatggagcagatatttttttatat
aatgctaatcggatacctgtcatctcattaaatcaagcatcaatagctagctttctcaca
gtgctagcttggtatccaaatactttgctccggacgtggtgccttgtgcttcatagctta
acactcatgacgaatatgcagcttaattctggttccagcagttctattggaattcaggag
actacggctcatctgttggtttcagatccaaaccttattcatgtgttagtgaaatttctt
tctggtaccagtcctcatgggacgaatcagcatagcccacaggttggtccaacagctaca
caagccatgcaggaatttctcacccgactacaagtgcatttgtcttcaacatgtccccag
atattcagtgaacttttgctcaagttaattcacatactgtccacagaaaggggggccttc
cagacagggcaaggacctcttgatgcccaagtgaagctgttagagtttactctggagcag
aactttgaagttgtctcagttagtacgatttctgctgtgatagagtctgtcaccttcttg
gtgcatcattacatcacttgctccgacaaagtcatgtctagaagtgggtcagacagctct
gccggtgctcgggcttgctttgggggactctttgctaacctcattcgtccaggtgatgca
aaagctgtttgtggtgaaatgacaagagatcaactcatgtttgatttgttaaaacttgtt
aacattttagtacagctgcctctttcaagcaatagggaatacagcgcaagagtgtccgtg
accaccaatacaacagatagtgtttcagatgaagaaaaagtctcaggaggcaaagatgtc
aatggaagcagtgccagcactccaggatctcctgcatgtgttgctgacttagtcttagcc
aaccagcaaattatgagccagattctgtctgccctaggcctgtgtaatagcagtgccatg
gcaatgataattggtgcaagtggcttacatctcaccaaacatgagaacttccatggtggg
ttagatgccatatcagttggagatggattatttaccatattgacaacacttagtaagaaa
gcctctacagtccacatgatgttgcagccaatcttgacctacatggcctgtggatacatg
ggcagacaaggctctcttgctacttgccagttatctgagccattgttgtggtttatcttg
agagtgttggatactagtgatgcattgaaagctttccatgatatgggtggagttcagctc
atatgcaataatatggttaccagtacaagggctattgtgaacactgcaagaagtatggta
tcaactattatgaaatttcttgattctggaccaaataaagctgttgacagcactttgaaa
acaaggatcctggcctctgagcctgacaatgcagaaggaatccataactttgcaccactt
ggtaccatcacttctagtagtcctactgcccagccagctgaggtgctcctgcaagccaca
ccgccccatcgaagagctcgttctgctgcttggtcctacatctttctgcctgaggaagcc
tggtgtgaccttaccatccaccttccgtcagcagtgctgctgaaggagatacacattcaa
cctcacctcgcatctctcgcaacctgcccatcgtcagtgtctgttgaagtaagtgcagat
ggtgttaatatgctccctttgtctactcctgttgtcacaagcggtctcacctacataaaa
attcagcttgtcaaagccgaagtagcttctgctgtctgcctcagactccatcgtcctcgg
gacgccagcacactaggcctctcacagattaaattattaggccttactgcttttggtacc
acctcatcagccacagttaataatccctttcttccatctgaagatcaagtttctaaaaca
agcattggatggttacggttattacatcattgccttacacatataagtgatctagaaggg
atgatggccagtgcagctgcccctactgccaacctgctgcagacttgtgctgccttactg
atgtctccatactgtgggatgcattcccccaacattgaggttgtgctggtaaagattggg
ttgcagtccactagaattggcctgaagcttattgacattctcctgaggaattgcgcagca
tcaggcagcgatcctacagatttaaatagccctttactttttggaaggctgaatggactg
tcctctgattctacaatagatattctttaccagcttggtacaactcaggatcctggaact
aaagacagaattcaggccttgctaaagtgggtcagtgactctgcaaaaatggctgctttg
aagagaagtggcagaatgaactatatgtgcccgagctcatcagctgtcgagtatggtctt
ctcatgccatccccctctcatttgcactgtgtagcagcgattctttggcacagttatgaa
ctgctggtggagtatgatttgccagcactgctagaccgagagctctttgagttacttttt
aattggtccatgtcacttccatgcaacgtggttttgaagaaagctgttgacagtctgctt
tgctccatgtgccatatacatccaaattatttttccttgctcatgggctggatgggaatt
atccctcctccggtgcagtgtcatcatagactatccatgacagatgatagcaagaagcaa
gatcttagttcatcattgacagatgactccaaaaatgcacaagcacctctgtctctaact
gaatcccacttggcaactcttgcttcttcttctcagtccccagaagctatcaaacagttg
ctagactcggggttgccttcccttctcgtgaggagtctggctagcttttgttttagtcac
atttcttactcagaaagcattgcccagtcagtagataattcccaggacaaactcaggcgg
catcacgttccacagcactgtaataagatgcccatcacagcagacctagtggctcccatc
cttaggtttttgacagaagttggcaatagtcatatcatgaaagattggcttggtggttct
gaagtcaacccactgtggacagcacttctgtttttgttgtgtcactctgggtctaccgct
ggaggacataatttaggggcacagcagagcagcacaaggtcagcttctcattcttcagct
actacaacagtcctgaccacccagcaacggacagccattgagaacgcaactgttgccttc
tttctgcagtgtatttcatgtcaccccaataaccaaaagctgatggcacaggttctctgt
gaactgtttcagacagcccctcaaaggggtagccttccaacatctgggaatatttccggg
tttgtgcgaagactgtttctacagttgatgctggaggatgagaaggtgacaatgtttctt
cagtcaccttgcccactatataaaggaagaattaatgcaactagccatgtcatccaacac
ccaatgtttggagcaggccataagtttcgtactctgcatttgccagtctcaacaacgttg
tcagatgtgcttgatagagtttcagatacaccaagtatcacagctaaacttattagtgag
caaaaagatgataaagaaaagaagaaccatgaagagaaagaaaaagttaaggcggaaaat
ggatttcaggataactacagcgttgttgttgcctctgggctgaaatcacagtctaagcgt
gccatggcatccacaccacctcgcccaccatccaggagaggaagaaccattcccgataag
atcggaagtgcatcctcaagcgcagacgcggccagcaaaatcatcaccgtgcccgtgttt
catctgttccacagactcctggcaggtcagccactaccagcagaaatgacacttgcccag
cttttaactctcctctatgaccgaaaacttcctcaaggttaccgttcaatagatcttact
gttaaattgggatcaaaagtcattacagatccaagtttgtcaaaaacagattctttcaaa
agactgcaccctgaaaaagatcatggagacttagttggcagctgtccagaggatgaggct
cttaccccgagtgatgagtgcatggatggagtattggatgaatctttgctggaaacctgt
cctattcagtcaccattacaagtttttgcaggaatgggtggactggctcttattgcagag
agactgcccatgctctatccagaagtgattcagcaggtgagtgctccagtgatcgcttcc
accactcaggaaaagccaaaggatagtgatcagtttgaatgggtgaccatagaacaatca
ggtgaactggtttatgaagctccagaaaccattgcagctgagcctccacctgttaagtca
gcggtgcaagccacgtctcccatacctgcccattctctggctgcttttggattatttctt
cgtcttccgggctatgctgaagtgctcctgaaagagaggaagcatgcccagtgccttctt
cgattggtgttgggagttacagatgatggagaaggcagtcacattctgcagtctccatca
gccaatgtgcttccaacccttcctttccacgttcttcgcagcttgtttagtgctactccc
ttgacaactgatgatggtgtgcttctgcggcggatggcactggagatcggagctttgcac
ctaattcttgtctgtctctcagctctgagtcatcacgcaccgcgagttccaaactctagc
cttagccaaactgagccgcaggtgtcaaattcccataaccccacatcagcagaagaacag
cagctgtactgggccaaagggactggctttggcacaggttccacggcatcaggatgggac
gtggaacaagccttaactaaacagaggctagaagaggagcatgtgacctgccttttgcag
gtccttgcgagttacataaaccccatgagtggtgctgtcaatggggaagcccaggcgtct
cccgagagccgcgcccagaacagcagtgctctgccctcggtgcttctggagctcctcagt
cagtcctgcctcatcccagccatgtcctcctacctgcgcaacgactccgttctggacatg
gcaagacatgtgccactctatcgtgctctgctagagttgctccgcgccattgcttcttgc
acatctatggtgccgctgttgttgcctctttctacagagaatggtgaagaagaggaagat
gaacagtcagaatgtcaaacttctgttggtacattattagctaaaatgaagacctgtgtc
gatacctacaccaaccgcctaagatctaaaagggaaaatgtgaaagccggagtcaagccg
gacgcgcctgatcaagagcccgaaggacttgcgcttctggtccccgacatccagaggact
gctgagatcgtccacgccgccaccgccaatctgcggcaagccaatcaagaaaaaaaacta
ggtgaatactcaaagaaggtggttatgaaacccaaacctctgtcagtattaaaatcactt
gaagaaaaatatgtggctgtcatgaaaaaactgcagtttgatacatttgaaatggtttct
gaagatgacgatgggaaattgggttttaaagtaaattaccactacatgtctcaggtgaaa
aatgccaacgatgccaacagtgctgccagagcccgccgcctggctcaagaagcggtgaca
ctgtcaacctcactgcctctgtcatcgtcttccagtgtctttgtacgctgtgatgaggag
cgacttgacatcatgaaggttctgataaccgggccagcggacaccccctatgcaaatggc
tgctttgagtttgatgtatattttcctcaagattatcctagctcacctcctctagtgaac
ctagaaacaactgggggtcatagtgtgcgcttcaatcccaacctttacaatgatggcaag
gtttgtttaagcatcctgaatacatggcatggaagaccagaagagaagtggaaccctcag
acatcaagctttttgcaagtgttggtttctgtccagtcccttatattagtagctgagcct
tacttcaatgaaccaggatatgaacggtctagaggcactcccagtggtacacagagctct
cgagaatacgatgggaacatccgacaagcaacggttaaatgggctatgctagaacaaatc
agaaatccttcaccgtgctttaaagaagttatacacaaacatttttacttgaagagaatt
gagctcatggcccagtgtgaggagtggattgcagacatccagcagtacagcagtgacaag
cgggtgggcaggaccatgtctcaccatgcagctgctctcaagcgccacactgctcagctc
cgagaagagctactgaaacttccctgccctgaaggcttagatccggacattgaggatgcc
tccccggtgtgcagggccacagcaggtgctgaagacactctaacccacgaccatgtcaat
cccagcagcagcaaagacctccccagtgacttccaattatga

DBGET integrated database retrieval system