KEGG   Mus musculus (house mouse): 12215
Entry
12215             CDS       T01002                                 
Symbol
Bsg, CD147, EMMPRIN, HT-7
Name
(RefSeq) basigin
  KO
K06535  basigin
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04148  Efferocytosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04148 Efferocytosis
    12215 (Bsg)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    12215 (Bsg)
   04090 CD molecules [BR:mmu04090]
    12215 (Bsg)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   12215 (Bsg)
CD molecules [BR:mmu04090]
 Proteins
  12215 (Bsg)
SSDB
Motif
Pfam: Ig_3 ig I-set Ig_2 V-set Ig_5 C2-set
Other DBs
NCBI-GeneID: 12215
NCBI-ProteinID: NP_033898
MGI: 88208
Ensembl: ENSMUSG00000023175
UniProt: P18572
Position
10:79540192..79547813
AA seq 389 aa
MAAALLLALAFTLLSGQGACAAAGFLKAPLSQERWAGGSVVLHCEAVGSPIPEIQWWFEG
NAPNDSCSQLWDGARLDRVHIHAAYRQHAASSLSVDGLTAEDTGTYECRASSDPDRNHLT
RPPRVKWVRAQASVVVLEPGTIQTSVQEVNSKTQLTCSLNSSGVDIVGHRWMRGGKVLQE
DTLPDLHTKYIVDADDRSGEYSCIFLPEPVGRSEINVEGPPRIKVGKKSEHSSEGELAKL
VCKSDASYPPITDWFWFKTSDTGEEEAITNSTEANGKYVVVSTPEKSQLTISNLDVNVDP
GTYVCNATNAQGTTRETISLRVRSRMAALWPFLGIVAEVLVLVTIIFIYEKRRKPDQTLD
EDDPGAAPLKGSGTHMNDKDKNVRQRNAT
NT seq 1170 nt   +upstreamnt  +downstreamnt
atggcggcggcgctgctgctggcgctggccttcacgctcttgagcggccaaggcgcctgc
gcggcggctggtttcctcaaggcaccactgtcgcaggagcggtgggcggggggcagcgtg
gtcctgcactgtgaggctgtgggcagccccatccccgagatccagtggtggtttgaaggg
aatgctccaaacgacagctgctcccagctctgggatggtgcccggctggaccgtgttcac
atccatgccgcctaccgtcagcatgcagccagttcgctctctgttgatgggctcaccgca
gaggacacaggcacttacgagtgccgggccagcagtgacccagaccgcaaccaccttact
cggccacccagggtcaagtgggtccgtgcccaggcgagcgtggtggtccttgaaccgggc
accatccaaacctctgtccaggaagtcaactccaaaacacagcttacctgctctttgaac
agcagtggcgttgacatcgttggccaccgctggatgagaggtggcaaggtactgcaggag
gacactctgcccgacctgcatacgaagtacatagtggacgcagatgaccgctctggggaa
tattcctgcatcttccttcctgagcctgtgggcagaagcgagatcaatgtggaagggcca
cccaggatcaaggtcggaaagaaatcagagcattccagtgagggagagcttgcgaaactg
gtctgcaagtccgatgcatcctaccctcctattacagattggttctggtttaagacctct
gacactggggaagaagaggcaatcaccaatagcactgaagccaatggcaagtatgtggtg
gtatccacgcctgagaagtcacagctgaccatcagcaaccttgacgtaaatgttgaccct
ggcacctacgtgtgtaatgccaccaacgcccagggcactactcgggaaaccatctcactg
cgtgtgcggagccgcatggcagccctctggcccttcctaggcatcgtggctgaggtcctg
gtgttggttaccatcatctttatctatgagaagaggcggaagccagaccagaccctggac
gaggatgaccctggcgccgccccactgaagggcagtggaactcacatgaatgacaaggac
aagaatgtacgccagaggaacgccacctga

DBGET integrated database retrieval system