KEGG   Mus musculus (mouse): 12223
Entry
12223             CDS       T01002                                 

Gene name
Btc, Bcn
Definition
(RefSeq) betacellulin, epidermal growth factor family member
  KO
K09783  betacellulin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    12223 (Btc)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    12223 (Btc)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   12223 (Btc)
SSDB
Motif
Pfam: EGF Shisa Cadherin_C_2 Baculo_11_kDa Sigma_reg_N TMEM154 EphA2_TM TMEM52 Vpu Comm Conotoxin OAD_gamma ETRAMP Tmemb_9
Other DBs
NCBI-GeneID: 12223
NCBI-ProteinID: NP_031594
MGI: 99439
Ensembl: ENSMUSG00000082361
Vega: OTTMUSG00000055524
UniProt: Q05928 Q543J8 Q3TP84
Position
5 E2; 5 44.78 cM
AA seq 177 aa
MDPTAPGSSVSSLPLLLVLALGLAILHCVVADGNTTRTPETNGSLCGAPGENCTGTTPRQ
KVKTHFSRCPKQYKHYCIHGRCRFVVDEQTPSCICEKGYFGARCERVDLFYLQQDRGQIL
VVCLIVVMVVFIILVIGVCTCCHPLRKHRKKKKEEKMETLDKDKTPISEDIQETNIA
NT seq 534 nt   +upstreamnt  +downstreamnt
atggacccaacagccccgggtagcagtgtcagctccctgccgctgctcctggtccttgcc
ctgggtcttgcaattctccactgtgtggtagcagatgggaacacaaccagaacaccagaa
accaatggctctctttgtggagctcctggggaaaactgcacaggtaccacccctagacag
aaagtgaaaacccacttctctcggtgccccaagcagtacaagcattactgcatccatggg
agatgccgcttcgtggtggacgagcaaactccctcctgcatctgtgagaaaggctacttt
ggggctcggtgtgagcgagtggacctgttttacctccagcaggaccgggggcagatcctg
gtggtctgcttgatagtggtcatggtggtgttcatcattttagtcatcggcgtctgcacc
tgctgtcatcctcttcggaaacatcgtaaaaaaaagaaggaagagaaaatggagactttg
gataaagataaaactcccataagtgaagatattcaagagaccaatattgcttaa

DBGET integrated database retrieval system