KEGG   Mus musculus (house mouse): 12226
Entry
12226             CDS       T01002                                 
Symbol
Btg1, AI426953, AW546738
Name
(RefSeq) BTG anti-proliferation factor 1
  KO
K14443  protein Tob/BTG
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    12226 (Btg1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    12226 (Btg1)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     12226 (Btg1)
  mRNA degradation factors
   3'-5' decay
    Other 3'-5' decay factors
     12226 (Btg1)
SSDB
Motif
Pfam: BTG
Other DBs
NCBI-GeneID: 12226
NCBI-ProteinID: NP_031595
MGI: 88215
Ensembl: ENSMUSG00000036478
UniProt: P62325 Q3UEG0
Position
10:96452863..96458675
AA seq 171 aa
MHPFYTRAATMIGEIAAAVSFISKFLRTKGLTSERQLQTFSQSLQELLAEHYKHHWFPEK
PCKGSGYRCIRINHKMDPLIGQAAQRIGLSSQELFRLLPSELTLWVDPYEVSYRIGEDGS
ICVLYEASPAGGSTQNSTNVQMVDSRISCKEELLLGRTSPSKNYNMMTVSG
NT seq 516 nt   +upstreamnt  +downstreamnt
atgcatcccttctacacccgggccgccaccatgataggcgagatcgccgccgcggtgtcc
ttcatctccaagttcctccgcaccaaggggctcacgagcgagcgacagctgcagactttc
agccagagcctgcaggagctgctggcagaacattacaaacatcactggttcccagaaaag
ccgtgcaagggatcaggttaccgttgtattcgcatcaaccataagatggatcctctgatt
ggacaggcagcccagcggattggactgagcagtcaggagttgttcaggcttctcccaagt
gaactcacactctgggttgacccctacgaagtgtcctaccggattggagaggatggctcc
atctgcgtgctgtacgaagcctcaccagcaggaggtagcactcaaaacagcaccaacgtg
caaatggtagacagcagaatcagctgtaaggaggaacttctcttgggcagaacaagccct
tccaaaaactacaatatgatgactgtatcaggttaa

DBGET integrated database retrieval system