KEGG   Mus musculus (house mouse): 12227
Entry
12227             CDS       T01002                                 
Symbol
Btg2, AA959598, APRO1, Pc3, TIS21
Name
(RefSeq) BTG anti-proliferation factor 2
  KO
K14443  protein Tob/BTG
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    12227 (Btg2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    12227 (Btg2)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     12227 (Btg2)
  mRNA degradation factors
   3'-5' decay
    Other 3'-5' decay factors
     12227 (Btg2)
SSDB
Motif
Pfam: BTG
Other DBs
NCBI-GeneID: 12227
NCBI-ProteinID: NP_031596
MGI: 108384
Ensembl: ENSMUSG00000020423
UniProt: Q04211 Q3TF68
Structure
Position
1:complement(134002603..134006893)
AA seq 158 aa
MSHGKRTDMLPEIAAAVGFLSSLLRTRGCVSEQRLKVFSRALQDALTDHYKHHWFPEKPS
KGSGYRCIRINHKMDPIISKVASQIGLSQPQLHRLLPSELTLWVDPYEVSYRIGEDGSIC
VLYEEAPVAASYGLLTCKNQMMLGRSSPSKNYVMAVSS
NT seq 477 nt   +upstreamnt  +downstreamnt
atgagccacgggaagagaaccgacatgctcccggagatcgccgccgccgtgggtttcctc
tccagtctcctgaggactcggggctgcgtgagcgagcagagactcaaggttttcagtagg
gcgctccaggacgcactgaccgatcattacaaacaccactggtttccagaaaaaccatcc
aaaggttctggctatcgctgtatccgtatcaaccacaagatggaccccatcatcagcaag
gtggccagccagattggactcagccagccccagctgcaccggctgctgcccagtgagctg
accctgtgggttgatccctatgaagtgtcttaccgcatcggggaggatggctccatctgt
gtcctgtatgaggaggccccggtggctgcctcctatgggctcctcacctgcaagaaccag
atgatgctgggcaggagcagcccctcgaagaactatgtgatggccgtctccagctag

DBGET integrated database retrieval system