KEGG   Mus musculus (house mouse): 12228
Entry
12228             CDS       T01002                                 
Symbol
Btg3, ANA, tob5
Name
(RefSeq) BTG anti-proliferation factor 3
  KO
K14443  protein Tob/BTG
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    12228 (Btg3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    12228 (Btg3)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     12228 (Btg3)
  mRNA degradation factors
   3'-5' decay
    Other 3'-5' decay factors
     12228 (Btg3)
SSDB
Motif
Pfam: BTG
Other DBs
NCBI-GeneID: 12228
NCBI-ProteinID: NP_001284676
MGI: 109532
Ensembl: ENSMUSG00000022863
UniProt: P50615 Q52L83
Position
16:complement(78156748..78174069)
AA seq 252 aa
MKNEIAAVVFFFTRLVRKHDKLKKEAVERFAEKLTQILQEKYKNHWYPEKPSKGQAYRCI
RVNKFQRVDPDVLKACENSCILYSDLGLPKELTLWVDPCEVCCRYGEKNNAFIVASFENE
DENKDEISKKVSRALDKVTSDYHSGSSSSDEDTSKEVDVKPSSVAATPSPVYQISELIFP
PLPMWHPLPRKKPGMYRGSGHQTHYPPPVPFAYPNPGRKNKPFRPIPVTWVPPPGMHCDR
NHWINPHMLAPH
NT seq 759 nt   +upstreamnt  +downstreamnt
atgaagaacgaaattgcggctgttgtcttctttttcacaaggctagttcgaaagcatgac
aagttgaaaaaagaagcagttgagaggtttgctgagaaattaactcaaatacttcaagag
aaatataaaaatcactggtatccagaaaaaccatccaaaggtcaggcctacagatgcatt
cgtgtcaataagtttcagagagttgatcccgatgtcctgaaagcctgtgagaacagctgc
atcttgtacagcgacctgggcttgcctaaggagcttacactctgggtggatccgtgtgag
gtgtgctgccggtatggagagaaaaacaatgcgttcattgttgccagctttgaaaatgag
gacgagaacaaggatgaaatctccaagaaagttagcagggctctggataaggtgacctct
gattatcactcagggtcctcttcctcagatgaagacacaagcaaggaagtggacgtgaaa
cccagctcagtggcggcaacaccaagccccgtgtaccagatttcagaactgatattccca
cctcttccaatgtggcaccctttgcccagaaaaaagccaggaatgtatcgagggagcggc
catcagactcactaccctcctcctgttccatttgcttatccaaatccaggaaggaagaat
aaaccattccgcccaattccagtgacatgggtacctcctcctggaatgcattgtgaccga
aatcactggattaatcctcacatgttagcacctcactag

DBGET integrated database retrieval system