KEGG   Mus musculus (mouse): 12229
Entry
12229             CDS       T01002                                 

Gene name
Btk, AI528679, xi, xid
Definition
(RefSeq) Bruton agammaglobulinemia tyrosine kinase
  KO
K07370  Bruton agammaglobulinemia tyrosine kinase [EC:2.7.10.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04064  NF-kappa B signaling pathway
mmu04380  Osteoclast differentiation
mmu04611  Platelet activation
mmu04662  B cell receptor signaling pathway
mmu04664  Fc epsilon RI signaling pathway
mmu05169  Epstein-Barr virus infection
mmu05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    12229 (Btk)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    12229 (Btk)
   04662 B cell receptor signaling pathway
    12229 (Btk)
   04664 Fc epsilon RI signaling pathway
    12229 (Btk)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    12229 (Btk)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    12229 (Btk)
  09163 Immune disease
   05340 Primary immunodeficiency
    12229 (Btk)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    12229 (Btk)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     12229 (Btk)
Protein kinases [BR:mmu01001]
 Non-receptor tyrosine kinases
  TEC family
   12229 (Btk)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_1 PH BTK SH3_9 Kinase-like SH3_2 SH3_3 SH3_10 ABC1 Kdo Pkinase_fungal APH Haspin_kinase SH3_4
Other DBs
NCBI-GeneID: 12229
NCBI-ProteinID: NP_038510
MGI: 88216
Ensembl: ENSMUSG00000031264
Vega: OTTMUSG00000019307
UniProt: P35991
Structure
PDB: 
4XI2 6MNY

Position
X E3; X 56.18 cM
AA seq 659 aa
MAAVILESIFLKRSQQKKKTSPLNFKKRLFLLTVHKLSYYEYDFERGRRGSKKGSIDVEK
ITCVETVIPEKNPPPERQIPRRGEESSEMEQISIIERFPYPFQVVYDEGPLYVFSPTEEL
RKRWIHQLKNVIRYNSDLVQKYHPCFWIDGQYLCCSQTAKNAMGCQILENRNGSLKPGSS
HRKTKKPLPPTPEEDQILKKPLPPEPTAAPISTTELKKVVALYDYMPMNANDLQLRKGEE
YFILEESNLPWWRARDKNGQEGYIPSNYITEAEDSIEMYEWYSKHMTRSQAEQLLKQEGK
EGGFIVRDSSKAGKYTVSVFAKSTGEPQGVIRHYVVCSTPQSQYYLAEKHLFSTIPELIN
YHQHNSAGLISRLKYPVSKQNKNAPSTAGLGYGSWEIDPKDLTFLKELGTGQFGVVKYGK
WRGQYDVAIKMIREGSMSEDEFIEEAKVMMNLSHEKLVQLYGVCTKQRPIFIITEYMANG
CLLNYLREMRHRFQTQQLLEMCKDVCEAMEYLESKQFLHRDLAARNCLVNDQGVVKVSDF
GLSRYVLDDEYTSSVGSKFPVRWSPPEVLMYSKFSSKSDIWAFGVLMWEIYSLGKMPYER
FTNSETAEHIAQGLRLYRPHLASERVYTIMYSCWHEKADERPSFKILLSNILDVMDEES
NT seq 1980 nt   +upstreamnt  +downstreamnt
atggctgcagtgatactggagagcatctttctgaagcgctcccagcagaaaaagaaaaca
tcacctttaaacttcaagaagcgcctgtttctcttgactgtacacaaactttcatactat
gaatatgactttgaacgtgggagaagaggcagtaagaaaggttcaatagatgttgagaag
atcacctgtgttgaaacagtaattcctgaaaaaaatcccccaccagaaagacagattccg
aggagaggtgaggagtctagtgaaatggaacagatttcaatcattgaaaggttcccgtac
ccattccaggttgtatatgatgaaggacctctctatgttttctccccaactgaagagctg
agaaagcgctggattcaccagctcaaaaatgtaatccggtacaatagtgacctggtacag
aaataccatccttgcttctggattgatggacagtatctctgctgctctcagacagccaag
aatgctatgggctgccaaattttggagaacaggaatggaagcttaaaacctgggagttct
catcgaaaaacgaaaaagcctcttccccctaccccagaggaagatcagatcttgaaaaaa
ccgcttcccccggagccaacagcagcaccaatctccacaaccgagctgaaaaaggtcgtg
gccctttatgattacatgccaatgaacgcaaatgacttacaattgcgaaagggcgaggag
tattttatcctggaggagagcaacctaccgtggtggcgagcacgagataaaaatgggcag
gaaggctacatcccaagtaactatatcactgaagctgaggactccatagagatgtatgag
tggtattccaagcacatgactcgaagtcaagctgagcaactgctaaagcaagaggggaaa
gaaggaggtttcattgtcagagactccagcaaagctggaaaatacaccgtgtctgtgttt
gctaaatctactggggagcctcaaggggtgatccgccattacgttgtgtgttccacgcca
cagagccagtattacctggctgagaaacacctcttcagcaccatccctgagctcattaac
taccatcaacacaactctgcaggcctcatatccaggctgaaatatcctgtgtctaaacaa
aacaaaaacgcgccttctactgcaggcctgggctatggatcatgggaaattgatccaaag
gacctcaccttcttgaaggagcttgggactggacaattcggtgtcgtgaaatatgggaag
tggaggggccaatatgatgtggccatcaagatgatcagagaaggttccatgtcggaggat
gaattcattgaagaagccaaagtcatgatgaatctttcccatgagaagctggtgcagttg
tatggcgtctgcaccaaacaacgccccatcttcatcatcaccgagtacatggctaatggc
tgcctcttgaactacctgagggagatgcggcaccgcttccagacacagcagctgcttgag
atgtgcaaagatgtctgtgaagcaatggaatacttggagtcgaagcagttccttcacaga
gacctggcagctcgaaactgtttggtaaacgatcaaggagttgtgaaagtatctgacttt
ggcctgtctaggtatgtccttgatgatgagtacaccagctctgtaggctccaagtttcca
gtccggtggtctccaccagaagtgcttatgtatagcaagttcagcagcaaatctgacatc
tgggcttttggggttttaatgtgggagatctactccctggggaagatgccgtatgagaga
tttactaacagtgagacagcagaacacattgctcaaggcttacgtctctacaggcctcat
ctggcatcagagagggtatataccatcatgtacagctgctggcacgagaaagcagatgaa
cgtcctagtttcaaaattctcttgagtaacattctagatgtgatggatgaagaatcctga

KEGG   Mus musculus (mouse): 21682
Entry
21682             CDS       T01002                                 

Gene name
Tec
Definition
(RefSeq) tec protein tyrosine kinase
  KO
K07364  tyrosine-protein kinase Tec [EC:2.7.10.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04380  Osteoclast differentiation
mmu04660  T cell receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    21682 (Tec)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    21682 (Tec)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    21682 (Tec)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     21682 (Tec)
Protein kinases [BR:mmu01001]
 Non-receptor tyrosine kinases
  TEC family
   21682 (Tec)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 PH SH3_1 BTK SH3_9 SH3_2 SH3_3 ABC1 Kinase-like SH3_10 APH
Other DBs
NCBI-GeneID: 21682
NCBI-ProteinID: NP_001106931
MGI: 98662
Ensembl: ENSMUSG00000029217
Vega: OTTMUSG00000025011
UniProt: P24604 Q3U436 Q3TH41
Structure
PDB: 
1GL5

Position
5 C3.2; 5 38.44 cM
AA seq 630 aa
MNFNTILEEILIKRSQQKKKTSPLNYKERLFVLTKSVLSYYEGRAEKKYRKGVIDISKIK
CVEIVKNDDGVIPCQNKFPFQVVHDANTLYIFAPSPQSRDRWVKKLKEEIKNNNNIMIKY
HPKFWADGSYQCCRQTEKLAPGCEKYNLFESSIRKTLPPAPEIKKRRPPPPIPPEEENTE
EIVVAMYDFQATEAHDLRLERGQEYIILEKNDLHWWRARDKYGSEGYIPSNYVTGKKSNN
LDQYEWYCRNTNRSKAEQLLRTEDKEGGFMVRDSSQPGLYTVSLYTKFGGEGSSGFRHYH
IKETATSPKKYYLAEKHAFGSIPEIIEYHKHNAAGLVTRLRYPVSTKGKNAPTTAGFSYD
KWEINPSELTFMRELGSGLFGVVRLGKWRAQYKVAIKAIREGAMCEEDFIEEAKVMMKLT
HPKLVQLYGVCTQQKPIYIVTEFMERGCLLNFLRQRQGHFSRDMLLSMCQDVCEGMEYLE
RNSFIHRDLAARNCLVNEAGVVKVSDFGMARYVLDDQYTSSSGAKFPVKWCPPEVFNYSR
FSSKSDVWSFGVLMWEIFTEGRMPFEKNTNYEVVTMVTRGHRLHRPKLASKYLYEVMLRC
WQERPEGRPSFEDLLRTIDELVECEETFGR
NT seq 1893 nt   +upstreamnt  +downstreamnt
atgaatttcaacactatcctagaagagattcttattaaaaggtcccagcagaaaaagaag
acatcacccttaaactacaaagagagactttttgtacttacaaaatccgtgttgagctac
tatgagggtcgagcggagaagaaatacagaaagggcgtcattgatatttccaaaatcaag
tgtgtggagatagtgaagaacgatgatggtgtcattccctgtcaaaataaatttccattc
caggttgttcatgatgctaatacactttatatttttgcacctagtccacaaagcagggac
cgatgggtgaagaagttaaaagaagaaataaagaacaacaataatatcatgattaaatac
catcctaaattctgggcagatgggagttaccagtgttgtagacaaacagaaaaactagca
cccggatgtgagaagtacaatctttttgagagtagtataagaaagaccctgcctcccgcg
ccagaaataaagaagagaaggcctcctccaccaattcccccagaggaagaaaatactgaa
gaaatcgttgtagcgatgtatgacttccaagcgacggaagcacatgacctcaggttagag
agaggccaagagtatatcatcctggaaaagaatgacctccattggtggagagcgagagat
aagtatgggagtgaaggatatatcccaagtaattacgtcacagggaagaaatccaacaac
ttagatcaatatgagtggtactgcagaaataccaacagaagcaaagcagaacagctcctc
agaacggaagataaagaaggtggttttatggtgagagactccagtcaaccaggcttgtac
actgtctccctttacacaaagtttgggggagaaggctcatcaggtttcaggcattatcac
ataaaggaaacagcaacatccccaaagaagtattacctggcagagaagcatgctttcggg
tccattcctgagatcattgaatatcacaagcacaatgcggcagggcttgtcaccaggctg
cggtacccggtcagtacaaaggggaagaacgctcccactactgccggcttcagctatgat
aagtgggagattaacccatcagagctgacctttatgagagagttggggagcggactgttt
ggagtggtgaggcttggcaagtggcgggcccagtacaaagtggccatcaaagctatccgg
gaaggcgccatgtgtgaagaggatttcatagaggaagctaaagtcatgatgaagctgaca
caccccaagctggtacagctctatggtgtatgcacccagcagaagcccatctacatcgtt
accgagttcatggaacggggctgccttctgaatttcctccggcagagacaaggccatttc
agcagagacatgctgctaagcatgtgtcaagatgtctgtgaagggatggagtacctggag
agaaacagcttcatccacagagacctggctgccagaaattgtctagtgaatgaagcagga
gttgtcaaagtatctgattttggaatggccaggtacgttctggatgatcagtacacaagt
tcttctggcgccaagttccctgtgaagtggtgtcccccagaagtgtttaattacagccgc
tttagcagcaagtcagacgtctggtcgtttggtgtgctaatgtgggaaatattcacagaa
ggcaggatgccctttgagaagaacaccaattacgaagtggtaaccatggtgactcgtggc
caccgcctccaccggccaaagctggcttccaaatatttgtatgaggtgatgctgagatgc
tggcaagagagaccagagggaaggccttcctttgaagacttgctgcgtacgatagatgaa
ctagttgaatgtgaagaaacttttggaagatga

DBGET integrated database retrieval system