KEGG   Mus musculus (house mouse): 12231
Entry
12231             CDS       T01002                                 
Symbol
Btn1a1, Btn
Name
(RefSeq) butyrophilin, subfamily 1, member A1
  KO
K06712  butyrophilin
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    12231 (Btn1a1)
   04090 CD molecules [BR:mmu04090]
    12231 (Btn1a1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   12231 (Btn1a1)
CD molecules [BR:mmu04090]
 Proteins
  12231 (Btn1a1)
SSDB
Motif
Pfam: PRY SPRY V-set Ig_3 I-set ig C2-set_2 Ig_2 Izumo-Ig Saf_2TM
Other DBs
NCBI-GeneID: 12231
NCBI-ProteinID: NP_038511
MGI: 103118
Ensembl: ENSMUSG00000000706
UniProt: Q62556 Q3UQC0 Q3UM26
Position
13:complement(23641154..23650084)
AA seq 524 aa
MAVPTNSCLLVCLLTLTVLQLPTLDSAAPFDVTAPQEPVLALVGSDAELTCGFSPNASSE
YMELLWFRQTRSTAVLLYRDGQEQEGQQMTEYRGRATLATAGLLDGRATLLIRDVRVSDQ
GEYRCLFKDNDDFEEAAVYLKVAAVGSDPQISMTVQENGEMELECTSSGWYPEPQVQWRT
GNREMLPSTSESKKHNEEGLFTVAVSMMIRDSSIKNMSCCIQNILLGQGKEVEISLPAPF
VPRLTPWIVAVAIILLALGFLTIGSIFFTWKLYKERSSLRKKEFGSKERLLEELRCKKTV
LHEVDVTLDPDTAHPHLFLYEDSKSVRLEDSRQILPDRPERFDSWPCVLGRETFTSGRHY
WEVEVGDRTDWAIGVCRENVVKKGFDPMTPDNGFWAVELYGNGYWALTPLRTSLRLAGPP
RRVGVFLDYDAGDISFYNMSNGSLIYTFPSISFSGPLRPFFCLWSCGKKPLTICSTANGP
EKVTVIANVQDDIPLSPLGEGCTSGDKDTLHSKLIPFSPSQAAP
NT seq 1575 nt   +upstreamnt  +downstreamnt
atggcagttcccaccaactcctgcctcctggtctgtctgctcaccctcactgtcctacag
ctgcccacgctggattcggcagctcccttcgatgtgaccgcacctcaggagccagtgttg
gccctagtgggctcagatgccgagctgacctgtggcttttccccaaacgcgagctcagaa
tacatggagctgctgtggtttcgacagacgaggtcgacagcggtacttctataccgggat
ggccaggagcaggagggccagcagatgacggagtaccgcgggagggcgacgctggcgaca
gccgggcttctagacggccgcgctactctgctgatccgagatgtcagggtctcagaccag
ggggagtaccggtgccttttcaaagacaacgacgacttcgaggaggccgccgtatacctc
aaagtggctgctgtgggttcagatcctcaaatcagtatgacggttcaagagaatggagaa
atggagctggagtgcacctcctctggatggtacccagagcctcaggtgcagtggagaaca
ggcaacagagagatgctaccatccacgtcagagtccaagaagcataatgaggaaggcctg
ttcactgtggcagtttcaatgatgatcagagacagctccataaagaacatgtcctgctgc
atccagaatatcctccttggccaggggaaggaagtagagatctccttaccagctcccttc
gtgccaaggctgactccctggatagtagctgtggctatcatcttactggccttaggattt
ctcaccattgggtccatatttttcacttggaaactatacaaggaaagatccagtctgcgg
aagaaggaatttggctctaaagagagacttctggaagaactcagatgcaaaaagactgta
ctgcatgaagttgacgtgactctggatccagacacagcccacccccacctcttcctgtat
gaagattcaaagtcagttcgattggaagattcacgtcagatcctgcctgatagaccagag
agatttgactcctggccctgtgtgttgggccgtgagacctttacttcagggagacattac
tgggaggtggaggtgggagatagaactgactgggccattggtgtgtgtagggagaatgtg
gtgaagaaagggtttgaccccatgactcctgataatgggttctgggctgtggagttgtat
ggaaatgggtactgggccctcaccccactcaggacctctctccgattagcagggccccct
cgcagagttggggtttttctggactatgacgcaggagacatttccttctacaacatgagt
aacggatctcttatctatactttccctagcatctctttctctggccccctccgtcccttc
ttttgtctgtggtcctgtggtaaaaagcccctgaccatctgttcaactgccaatgggcct
gagaaagtcacagtcattgctaatgtccaggacgacattcccttgtccccgctgggggaa
ggctgtacttctggagacaaagacactctccattctaaactgatcccgttctcacctagc
caagcggcaccataa

DBGET integrated database retrieval system