KEGG   Mus musculus (mouse): 12235
Entry
12235             CDS       T01002                                 

Gene name
Bub1, AL022991, Bub1a, C80208, D2Xrf8, D2Xrf87
Definition
(RefSeq) BUB1, mitotic checkpoint serine/threonine kinase
  KO
K02178  checkpoint serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04110  Cell cycle
mmu04114  Oocyte meiosis
mmu04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    12235 (Bub1)
   04114 Oocyte meiosis
    12235 (Bub1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    12235 (Bub1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    12235 (Bub1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    12235 (Bub1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     12235 (Bub1)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: Other
  BUB family
   12235 (Bub1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Core SAC proteins
     12235 (Bub1)
SSDB
Motif
Pfam: Mad3_BUB1_I Pkinase PK_Tyr_Ser-Thr Mad3_BUB1_I_2
Other DBs
NCBI-GeneID: 12235
NCBI-ProteinID: NP_033902
MGI: 1100510
Ensembl: ENSMUSG00000027379
Vega: OTTMUSG00000016093
UniProt: O08901
Position
2 F1; 2 62.1 cM
AA seq 1058 aa
MDNLENVFRMFEAHMQSYTGNDPLGEWESFIKWVEENFPDNKEYLMTLLEHLMKEFLHKK
NYHNDSRFINYCLKFAEYNSDRHQFFEFLYNQGIGTKSSYIYMSWAGHLEAQGELQHASA
IFQTGIHNEAEPKELLQQQYRLFQARLTGIHLPAQATTSEPLHSAQILNQVMMTNSSPEK
NSACVPRSQGSECSGVASSTCDEKSNMEQRVIMISKSECSVSSSVAPKPEAQQVMYCKEK
LIRGDSEFSFEELRAQKYNQRKKHEQWVSEDRNYMKRKEANAFEEQLLKQKMDELHKKLH
QVVELSHKDLPASENRPDVSLVCVGQNTCSQQELRGPSLSSISHQTSESSGEKPQEEPSV
PLMVNAVNSTLLFPAANLPALPVPVSGQSLTDSRCVNQSVHEFMPQCGPETKEVCETNKV
ASINDFHTTPNTSLGMVQGTPCKVQPSPTVHTKEALGFIMDMFQAPTLPDISDDKDEWPS
LDQNEDAFEAQFQKNAVSSGDWGVKKIMTLSSAFPIFEDGNKENYGLPQPKNKPLGARTF
GERSLSKYSSRSNEMPHTDEFMDDSTVCGIRCNKTLAPSPKSIGDFTSAAQLSSTPFHKF
PADLVQIPEDKENVVATQYTHMALDSCKENIVDLSKGRKLGPIQEKISASLPCPSQPATG
GLFTQEAVFGLEAFKCTGIDHATVEDLSDANAGLQVECVQTLGNVNAPSFTVENPWDDEL
ILKLLSGLSKPVTSYSNTFEWQSKLPAIKTKTEYQLGSLLVYVNHLLGEGAFAQVFEAIH
GDVRNAKSEQKCILKVQRPANSWEFYIGMQLMERLKPEVHHMFIKFYSAHLFKNGSILVG
ELYSYGTLLNVINLYKNTSEKVMPQALVLTFAIRMLYMVEQVHSCEIIHGDIKPDNFILG
HRFLEQADEDLATGLALIDLGQSIDMKLFPKGTVFTGKCETSGFQCPEMLSNKPWNYQID
YFGVAATIYCMLFGSYMKVKNEGGVWKPEGLFRRLPHLDMWEEFFHIMLNIPDCHNLPSL
DFLRQNMKKLLEQQYSNKIKTLRNRLIVMLSEYKRSRK
NT seq 3177 nt   +upstreamnt  +downstreamnt
atggacaacctagaaaatgtctttcgcatgtttgaagcccatatgcaaagctacacgggt
aatgacccacttggagaatgggaaagctttataaagtgggtagaagagaattttcctgac
aataaagaatacttgatgacattattagaacatttaatgaaggaatttttacataagaag
aactaccacaatgattcaagattcatcaattattgcttaaaatttgctgagtacaacagt
gaccgtcatcagttttttgagtttctgtacaaccagggaattggaaccaagtcatcatat
atatacatgtcctgggcagggcatctggaagcccagggagagctgcagcatgccagtgct
atttttcagacaggaattcacaatgaggctgaacctaaagaactactacagcaacaatac
aggctattccaagcacgccttactggaatccatttgccagctcaagctacaacctcagaa
cctttgcatagtgcacagattttaaaccaagttatgatgacaaactcaagtccagaaaaa
aactcagcctgtgttcctaggagtcagggttcagaatgttctggtgtggcatcttccact
tgtgatgaaaagtctaatatggaacaaagggtgatcatgatttccaagtcagaatgctct
gtcagctcatctgtggcacccaagcctgaggctcagcaagttatgtactgcaaggaaaag
cttattcgtggagattcagaattttcttttgaagaactgagagcccagaaatataatcaa
aggaagaagcatgagcagtgggttagtgaagacagaaattatatgaaaaggaaagaagca
aatgcttttgaagagcaattattaaaacagaaaatggatgaacttcacaagaaattgcat
caagtggtggaattgtcacacaaggaccttcctgcttctgagaacaggcctgatgttagt
ctagtatgtgttggacaaaatacttgctcccagcaggaattgaggggtccaagtctttca
tccatcagtcatcagacctcagagagttcaggagagaaaccacaggaagaaccttctgtt
cctcttatggtaaatgctgttaacagcactttgctgttcccagctgccaacctgccagct
cttcctgttcctgtaagtggccagtcattgacagactccagatgtgtgaatcaaagtgtt
catgaattcatgccacagtgtggaccagaaacaaaagaagtgtgtgaaacaaataaagtt
gccagcattaatgattttcatacaactccaaacacatcattgggaatggttcaaggaaca
ccatgcaaagtgcagccatcaccaactgtccacaccaaggaagcattaggtttcatcatg
gacatgtttcaggctccaacacttcctgacatttctgatgataaagatgaatggccatct
ctggaccaaaatgaagatgcatttgaagcccagtttcaaaaaaatgcagtatcttcggga
gattggggagttaaaaaaattatgactttgtcatctgcttttcctatttttgaagatgga
aacaaagaaaattatggcttaccacagcctaaaaataagcccttaggagctaggaccttt
ggagaacgatctctcagtaaatattcctcgagatcaaatgaaatgcctcacactgatgag
tttatggatgattcaacagtatgtggtattcgctgcaacaaaactctagctcccagtcct
aaaagtataggagactttacatctgctgcccaactttcgtctacaccattccacaaattt
ccagcagatttagtacagattccagaagataaagaaaatgtggtagccacacagtataca
catatggctttggattcttgtaaagaaaacatagtggacctctcaaaaggcagaaagctt
gggccaattcaagagaaaatttcagcatctttaccctgtcctagtcagcctgccacaggt
ggtttgttcacccaggaagcagtgttcggccttgaggcttttaaatgcacaggcattgac
catgcgacagtggaagacctatccgatgccaatgctgggctccaagttgaatgcgtgcag
acacttggaaatgtcaatgctccaagctttactgttgagaacccatgggatgacgaattg
attcttaaacttctctctggactttctaagccagttacttcctattcaaatacttttgag
tggcagagtaaacttccagccatcaagaccaagacagaatatcaattgggttctttgctg
gtctatgtgaatcaccttcttggagaaggagcctttgctcaagtctttgaagctattcat
ggagatgtgagaaatgccaaaagtgaacagaaatgcattttgaaggtgcagagacctgcc
aactcctgggaattctacattgggatgcagctgatggaaagactaaagccagaagtacat
cacatgttcatcaagttttattctgctcatttattcaagaatggcagcatattagtaggg
gaactctacagctatgggacgttactaaatgtcattaacctctataaaaatacctctgaa
aaagtgatgccccaggctcttgtcctcactttcgctatcagaatgctttacatggttgaa
caagtccacagctgcgaaatcattcatggagacattaagccagataacttcatactagga
cacagatttttggaacaggctgatgaagacttagctaccggcttggcattgattgacctg
ggtcagagtatagatatgaaacttttccctaaaggaactgtatttacaggaaaatgtgaa
acatctggttttcagtgtcctgagatgctcagtaacaagccatggaactaccagattgat
tactttggagttgctgcaacaatatactgtatgctctttggctcttacatgaaagtaaaa
aatgaaggaggagtctggaaacctgaaggtctttttagaaggcttcctcatttggatatg
tgggaggaattttttcacatcatgttgaatataccggattgtcataatcttccatctttg
gattttctgagacagaatatgaagaaattacttgaacaacagtattccaacaagattaag
accttgcgtaataggctaattgtgatgctttcagaatataagcgttcaagaaaataa

DBGET integrated database retrieval system