KEGG   Mus musculus (house mouse): 12237
Entry
12237             CDS       T01002                                 
Symbol
Bub3, AU019800, AU021329, AU043350, AW146323, C78067
Name
(RefSeq) BUB3 mitotic checkpoint protein
  KO
K02180  cell cycle arrest protein BUB3
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04110  Cell cycle
mmu05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    12237 (Bub3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    12237 (Bub3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:mmu03041]
    12237 (Bub3)
   03036 Chromosome and associated proteins [BR:mmu03036]
    12237 (Bub3)
Spliceosome [BR:mmu03041]
 Complex A
  Other components
   Complex A specific factors
    12237 (Bub3)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Core SAC proteins
     12237 (Bub3)
SSDB
Motif
Pfam: WD40 NBCH_WD40
Other DBs
NCBI-GeneID: 12237
NCBI-ProteinID: NP_001304279
MGI: 1343463
Ensembl: ENSMUSG00000066979
UniProt: Q9WVA3
Position
7:131162081..131173624
AA seq 326 aa
MTGSNEFKLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSMRLKYQHTGAVL
DCAFYDPTHAWSGGLDHQLKMHDLNTDQENLVGTHDAPIRCVEYCPEVNVMVTGSWDQTV
KLWDPRTPCNAGTFSQPEKVYTLSVSGDRLIVGTAGRRVLVWDLRNMGYVQQRRESSLKY
QTRCIRAFPNKQGYVLSSIEGRVAVEYLDPSPEVQKKKYAFKCHRLKENNIEQIYPVNAI
SFHNIHNTFATGGSDGFVNIWDPFNKKRLCQFHRYPTSIASLAFSNDGTTLAIASSYMYE
MDDTEHPEDGIFIRQVTDAETKPKST
NT seq 981 nt   +upstreamnt  +downstreamnt
atgaccggttcgaacgaattcaagctgaaccagccacccgaggatggcatctcctcggtt
aagttcagccccaacacatcccagttcctcctggtctcctcctgggatacgtctgtgcgc
ctctacgatgtgcccgccaattccatgaggctcaagtaccagcacactggtgctgtcctg
gactgcgccttctacgatccaacgcatgcctggagtggtggattagatcatcaactgaaa
atgcacgatttgaacactgatcaagaaaatcttgttggaactcacgatgcccctatcaga
tgtgttgaatactgtccagaagtgaacgtgatggtaactggaagttgggatcagacagtt
aaactgtgggaccccagaactccgtgtaatgctgggactttctcccagccggaaaaggtc
tacaccctgtcagtgtctggggacaggctgattgtgggcacggcgggccgccgagtgctg
gtgtgggacttgcggaacatgggctatgtgcagcagcggagggagtccagcctgaagtac
cagactcgctgcatccgagccttcccgaacaagcagggttatgtgttgagctccatcgaa
ggccgagtggctgtggaatacttggacccgagccctgaggtgcagaagaagaagtacgcc
ttcaagtgccacaggctaaaggagaacaacattgagcagatttacccagtcaacgccatc
tcctttcacaacatccacaacacgtttgccacaggtggttcggatggattcgtcaatatt
tgggacccatttaacaagaagcgcctgtgccagttccatcggtaccccaccagcatcgct
tcccttgccttcagtaatgacggaactacgcttgcaatagcatcgtcatatatgtatgag
atggatgacaccgagcatcctgaagatggtatcttcattcgccaagtgacagacgcagaa
acaaagcccaagtccacgtaa

DBGET integrated database retrieval system