KEGG   Mus musculus (mouse): 12258
Entry
12258             CDS       T01002                                 

Gene name
Serping1, C1I, C1INH, C1n, C1nh
Definition
(RefSeq) serine (or cysteine) peptidase inhibitor, clade G, member 1
  KO
K04001  C1 inhibitor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04610  Complement and coagulation cascades
mmu05133  Pertussis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    12258 (Serping1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05133 Pertussis
    12258 (Serping1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    12258 (Serping1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    12258 (Serping1)
Peptidases and inhibitors [BR:mmu01002]
 Peptidase inhibitors
  Family I4: serpin family
   12258 (Serping1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   12258 (Serping1)
SSDB
Motif
Pfam: Serpin
Other DBs
NCBI-GeneID: 12258
NCBI-ProteinID: NP_033906
MGI: 894696
Ensembl: ENSMUSG00000023224
Vega: OTTMUSG00000013680
UniProt: P97290
Position
2; 2 D
AA seq 504 aa
MASRLTPLTLLLLLLAGDRAFSDPEATSHSTQDPLEAQAKSRESFPERDDSWSPPEPTVL
PSTWPTTSVAITITNDTMGKVANESFSQHSQPAAQLPTDSPGQPPLNSSSQPSTASDLPT
QATTEPFCPEPLAQCSDSDRDSSEAKLSEALTDFSVKLYHAFSATKMAKTNMAFSPFSIA
SLLTQVLLGAGDSTKSNLESILSYPKDFACVHQALKGFSSKGVTSVSQIFHSPDLAIRDT
YVNASQSLYGSSPRVLGPDSAANLELINTWVAENTNHKIRKLLDSLPSDTCLVLLNAVYL
SAKWKITFEPKKMMAPFFYKNSMIKVPMMSSVKYPVAQFDDHTLKAKVGQLQLSHNLSFV
IVVPVFPKHQLKDVEKALNPTVFKAIMKKLELSKFLPTYLTMPHIKVKSSQDMLSVMEKL
EFFDFTYDLNLCGLTEDPDLQVSAMKHETVLELTESGVEAAAASAISFGRSLPIFEVQRP
FLFLLWDQQHRFPVFMGRVYDPRG
NT seq 1515 nt   +upstreamnt  +downstreamnt
atggcctccaggctgaccccactgaccctcctgctgctgctgctggctggggatagagcc
ttctcagatcccgaagctaccagccacagcacccaggatccactggaggctcaagcgaaa
agcagagagagcttccctgaaagagatgactcctggagtcccccagagcctacagtactg
ccctctacctggccaacaaccagtgtagccatcacaataacaaatgacaccatgggtaaa
gtagccaacgagtccttcagccagcacagccagccagctgctcagctacccacagattct
ccaggacagccccctctgaattcttccagccagccctccactgcctcagatcttcccacc
caggctactactgaacccttctgcccggagccgcttgctcagtgctctgattcagacaga
gactcctcagaggcaaagctctcagaggctttgacagatttctctgtgaagctctaccac
gccttctcagctaccaagatggctaagaccaacatggccttttccccattcagcattgcc
agcctcctcacacaggttcttcttggggctggagacagcaccaagagcaacttggagagc
atcctttcctaccccaaggattttgcctgtgtccaccaagcactaaagggcttttcatcc
aaaggtgtcacttctgtgtctcagattttccacagcccagatctggccataagggacacc
tatgtgaatgcatctcagagcctgtatggaagcagccccagagtcctgggcccagacagt
gctgctaacttagaactcatcaacacctgggtggctgagaacaccaaccataagatccgc
aagctgctggacagcctgccttctgacacctgcctcgtccttctcaatgctgtctacttg
agtgccaagtggaagataacatttgaaccaaaaaagatgatggcgcctttcttctacaaa
aactctatgattaaagtgcccatgatgagtagcgtaaagtaccctgtggcccaattcgat
gaccatactttgaaggccaaggtgggacagctgcagctctctcacaacctgagctttgtg
atcgtggtacccgtgttcccaaagcaccaacttaaagatgtagaaaaggctctcaacccc
actgtcttcaaggccatcatgaagaagctggagctgtccaaattcctgcccacttacctg
acgatgcctcatataaaagtaaagagcagccaagacatgctgtcagtcatggagaaactg
gaattctttgacttcacttacgatctcaacctgtgcgggctgaccgaggacccagatctt
caggtgtctgccatgaaacacgagacagtgctggaactgacagagtcaggggtggaagca
gctgcagcctctgccatctcctttggccgaagcttacccatctttgaggtgcagcgacct
ttcctcttcctgctctgggaccagcaacacaggttcccagtcttcatgggtcgtgtatat
gaccccaggggttga

DBGET integrated database retrieval system