KEGG   Mus musculus (mouse): 12259
Entry
12259             CDS       T01002                                 

Gene name
C1qa, AI255395, Adic, C1q
Definition
(RefSeq) complement component 1, q subcomponent, alpha polypeptide
  KO
K03986  complement C1q subcomponent subunit A
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04610  Complement and coagulation cascades
mmu05020  Prion disease
mmu05133  Pertussis
mmu05142  Chagas disease
mmu05150  Staphylococcus aureus infection
mmu05171  Coronavirus disease - COVID-19
mmu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    12259 (C1qa)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    12259 (C1qa)
  09171 Infectious disease: bacterial
   05133 Pertussis
    12259 (C1qa)
   05150 Staphylococcus aureus infection
    12259 (C1qa)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    12259 (C1qa)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    12259 (C1qa)
  09164 Neurodegenerative disease
   05020 Prion disease
    12259 (C1qa)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    12259 (C1qa)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Phagocytosis
   Opsonins
    12259 (C1qa)
SSDB
Motif
Pfam: C1q Collagen
Other DBs
NCBI-GeneID: 12259
NCBI-ProteinID: NP_031598
MGI: 88223
Ensembl: ENSMUSG00000036887
Vega: OTTMUSG00000009765
UniProt: P98086 A0A3B0IP04
Position
4 D3; 4 69.05 cM
AA seq 245 aa
METSQGWLVACVLTMTLVWTVAEDVCRAPNGKDGAPGNPGRPGRPGLKGERGEPGAAGIR
TGIRGFKGDPGESGPPGKPGNVGLPGPSGPLGDSGPQGLKGVKGNPGNIRDQPRPAFSAI
RQNPMTLGNVVIFDKVLTNQESPYQNHTGRFICAVPGFYYFNFQVISKWDLCLFIKSSSG
GQPRDSLSFSNTNNKGLFQVLAGGTVLQLRRGDEVWIEKDPAKGRIYQGTEADSIFSGFL
IFPSA
NT seq 738 nt   +upstreamnt  +downstreamnt
atggagacctctcagggatggctggtggcctgtgtgctgaccatgaccctagtatggaca
gtggctgaagatgtctgccgagcacccaacgggaaggatggggctccaggaaatcctggc
cgcccggggaggccgggtctcaaaggagagagaggggagccaggagctgctggcatccgg
actggtatccgaggttttaaaggagacccaggggaatctggcccccctggcaaacctggc
aatgtggggctcccaggtcccagtggtcccctgggggacagcggcccccaaggactgaag
ggcgtgaaaggcaatccaggcaatatcagggaccagccccggccagctttctcagccatt
cggcagaacccaatgacgcttggcaacgtggttatctttgacaaggtcctcaccaaccag
gagagtccataccagaaccacacgggtcgcttcatctgtgcagtgcccggcttctattac
ttcaacttccaagtgatctccaagtgggacctttgtctgtttatcaagtcttcctccggg
ggccagcccagggattccctgagtttctctaacaccaacaacaaggggctctttcaggtg
ttagcagggggcaccgtgcttcagctgcgacgaggggacgaggtgtggatcgaaaaggac
cccgcaaagggtcgcatttaccagggcactgaagccgacagcatcttcagcggattcctc
attttcccctcggcctga

KEGG   Mus musculus (mouse): 12260
Entry
12260             CDS       T01002                                 

Gene name
C1qb, Adia
Definition
(RefSeq) complement component 1, q subcomponent, beta polypeptide
  KO
K03987  complement C1q subcomponent subunit B
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04610  Complement and coagulation cascades
mmu05020  Prion disease
mmu05133  Pertussis
mmu05142  Chagas disease
mmu05150  Staphylococcus aureus infection
mmu05171  Coronavirus disease - COVID-19
mmu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    12260 (C1qb)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    12260 (C1qb)
  09171 Infectious disease: bacterial
   05133 Pertussis
    12260 (C1qb)
   05150 Staphylococcus aureus infection
    12260 (C1qb)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    12260 (C1qb)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    12260 (C1qb)
  09164 Neurodegenerative disease
   05020 Prion disease
    12260 (C1qb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    12260 (C1qb)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Phagocytosis
   Opsonins
    12260 (C1qb)
SSDB
Motif
Pfam: C1q Collagen BclA_C
Other DBs
NCBI-GeneID: 12260
NCBI-ProteinID: NP_033907
MGI: 88224
Ensembl: ENSMUSG00000036905
Vega: OTTMUSG00000009766
UniProt: P14106
Position
4 D3; 4 69.05 cM
AA seq 253 aa
MKTQWGEVWTHLLLLLLGFLHVSWAQSSCTGPPGIPGIPGVPGVPGSDGQPGTPGIKGEK
GLPGLAGDLGEFGEKGDPGIPGTPGKVGPKGPVGPKGTPGPSGPRGPKGDSGDYGATQKV
AFSALRTINSPLRPNQVIRFEKVITNANENYEPRNGKFTCKVPGLYYFTYHASSRGNLCV
NLVRGRDRDSMQKVVTFCDYAQNTFQVTTGGVVLKLEQEEVVHLQATDKNSLLGIEGANS
IFTGFLLFPDMDA
NT seq 762 nt   +upstreamnt  +downstreamnt
atgaagacacagtggggtgaggtctggacacacctgttactgctgcttctaggttttctc
catgtgtcctgggcccaaagcagctgcaccgggccccctggcatccctggcatccctggg
gtccctggggttcctggctctgatggccaaccaggcactccagggataaagggggagaaa
gggctccctggactggctggagaccttggtgagtttggagagaaaggggacccagggatc
cctgggactccaggcaaagttggccctaagggtcccgtcggccctaagggtactccaggc
ccctctggaccccgcggtcccaaaggcgattctggggactacggggctacacagaaagtc
gccttctctgccctgaggaccatcaacagccccttgcgaccgaaccaggtcattcgcttc
gaaaaggtgatcaccaacgcgaacgagaactatgagccacgcaacggcaagttcacctgc
aaggtgcctggcctctactacttcacctatcatgccagctcccggggcaacctgtgtgtg
aatctcgttcgtggccgcgatcgggacagcatgcagaaagtagtcaccttctgtgactat
gcccagaacaccttccaggtgaccacaggtggggtagtcttgaagctagagcaagaggag
gttgttcacctgcaggccacagacaagaactccctcctgggcattgagggtgccaacagc
atcttcactggctttctgcttttccctgacatggatgcgtaa

KEGG   Mus musculus (mouse): 12262
Entry
12262             CDS       T01002                                 

Gene name
C1qc, AI385742, Adib, C1qg, Ciqc
Definition
(RefSeq) complement component 1, q subcomponent, C chain
  KO
K03988  complement C1q subcomponent subunit C
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04610  Complement and coagulation cascades
mmu05020  Prion disease
mmu05133  Pertussis
mmu05142  Chagas disease
mmu05150  Staphylococcus aureus infection
mmu05171  Coronavirus disease - COVID-19
mmu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    12262 (C1qc)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    12262 (C1qc)
  09171 Infectious disease: bacterial
   05133 Pertussis
    12262 (C1qc)
   05150 Staphylococcus aureus infection
    12262 (C1qc)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    12262 (C1qc)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    12262 (C1qc)
  09164 Neurodegenerative disease
   05020 Prion disease
    12262 (C1qc)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    12262 (C1qc)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Phagocytosis
   Opsonins
    12262 (C1qc)
SSDB
Motif
Pfam: C1q Collagen BclA_C
Other DBs
NCBI-GeneID: 12262
NCBI-ProteinID: NP_031600
MGI: 88225
Ensembl: ENSMUSG00000036896
Vega: OTTMUSG00000009764
UniProt: Q02105
Position
4 D3; 4 69.05 cM
AA seq 246 aa
MVVGPSCQPPCGLCLLLLFLLALPLRSQASAGCYGIPGMPGMPGAPGKDGHDGLQGPKGE
PGIPAVPGTRGPKGQKGEPGMPGHRGKNGPRGTSGLPGDPGPRGPPGEPGVEGRYKQKHQ
SVFTVTRQTTQYPEANALVRFNSVVTNPQGHYNPSTGKFTCEVPGLYYFVYYTSHTANLC
VHLNLNLARVASFCDHMFNSKQVSSGGVLLRLQRGDEVWLSVNDYNGMVGIEGSNSVFSG
FLLFPD
NT seq 741 nt   +upstreamnt  +downstreamnt
atggtcgttggacccagttgccagcctccatgtggactttgcctgctgctgctgtttctt
ctggccctaccactcaggagccaggccagcgctggctgctatgggatcccagggatgcca
ggcatgccgggggcccctgggaaggacgggcatgatggactccaggggcccaagggagag
ccaggaatcccagccgtccctgggacccgaggacccaagggtcagaagggcgagcctggc
atgcctggccaccgtgggaaaaatggccccagggggacctcagggttgccaggggaccca
ggccccagggggcctccgggggagccaggtgtggagggccgatacaaacagaagcaccag
tcggtattcacagtcacccggcagaccacccagtacccagaggccaacgccctcgtcagg
ttcaactctgtggtcaccaaccctcaggggcattacaacccaagcacagggaagttcacc
tgtgaagtgccgggcctctactacttcgtctactacacatcgcatacggccaacctgtgc
gtgcacctgaacctcaaccttgccagggtggccagcttctgcgaccacatgttcaacagc
aagcaggtcagctccggaggagtcctcctgcggctccagaggggcgatgaggtgtggcta
tcagtcaatgactacaatggcatggtgggcatagagggctccaacagcgtcttctctggt
ttcctactgtttcccgactag

DBGET integrated database retrieval system