KEGG   Mus musculus (mouse): 12259
Entry
12259             CDS       T01002                                 

Gene name
C1qa, AI255395, Adic, C1q
Definition
(RefSeq) complement component 1, q subcomponent, alpha polypeptide
  KO
K03986  complement C1q subcomponent subunit A
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04610  Complement and coagulation cascades
mmu05020  Prion disease
mmu05133  Pertussis
mmu05142  Chagas disease
mmu05150  Staphylococcus aureus infection
mmu05171  Coronavirus disease - COVID-19
mmu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    12259 (C1qa)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    12259 (C1qa)
  09171 Infectious disease: bacterial
   05133 Pertussis
    12259 (C1qa)
   05150 Staphylococcus aureus infection
    12259 (C1qa)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    12259 (C1qa)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    12259 (C1qa)
  09164 Neurodegenerative disease
   05020 Prion disease
    12259 (C1qa)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    12259 (C1qa)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Phagocytosis
   Opsonins
    12259 (C1qa)
SSDB
Motif
Pfam: C1q Collagen
Other DBs
NCBI-GeneID: 12259
NCBI-ProteinID: NP_031598
MGI: 88223
Ensembl: ENSMUSG00000036887
Vega: OTTMUSG00000009765
UniProt: P98086 A0A3B0IP04
Position
4 D3; 4 69.05 cM
AA seq 245 aa
METSQGWLVACVLTMTLVWTVAEDVCRAPNGKDGAPGNPGRPGRPGLKGERGEPGAAGIR
TGIRGFKGDPGESGPPGKPGNVGLPGPSGPLGDSGPQGLKGVKGNPGNIRDQPRPAFSAI
RQNPMTLGNVVIFDKVLTNQESPYQNHTGRFICAVPGFYYFNFQVISKWDLCLFIKSSSG
GQPRDSLSFSNTNNKGLFQVLAGGTVLQLRRGDEVWIEKDPAKGRIYQGTEADSIFSGFL
IFPSA
NT seq 738 nt   +upstreamnt  +downstreamnt
atggagacctctcagggatggctggtggcctgtgtgctgaccatgaccctagtatggaca
gtggctgaagatgtctgccgagcacccaacgggaaggatggggctccaggaaatcctggc
cgcccggggaggccgggtctcaaaggagagagaggggagccaggagctgctggcatccgg
actggtatccgaggttttaaaggagacccaggggaatctggcccccctggcaaacctggc
aatgtggggctcccaggtcccagtggtcccctgggggacagcggcccccaaggactgaag
ggcgtgaaaggcaatccaggcaatatcagggaccagccccggccagctttctcagccatt
cggcagaacccaatgacgcttggcaacgtggttatctttgacaaggtcctcaccaaccag
gagagtccataccagaaccacacgggtcgcttcatctgtgcagtgcccggcttctattac
ttcaacttccaagtgatctccaagtgggacctttgtctgtttatcaagtcttcctccggg
ggccagcccagggattccctgagtttctctaacaccaacaacaaggggctctttcaggtg
ttagcagggggcaccgtgcttcagctgcgacgaggggacgaggtgtggatcgaaaaggac
cccgcaaagggtcgcatttaccagggcactgaagccgacagcatcttcagcggattcctc
attttcccctcggcctga

KEGG   Mus musculus (mouse): 12260
Entry
12260             CDS       T01002                                 

Gene name
C1qb, Adia
Definition
(RefSeq) complement component 1, q subcomponent, beta polypeptide
  KO
K03987  complement C1q subcomponent subunit B
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04610  Complement and coagulation cascades
mmu05020  Prion disease
mmu05133  Pertussis
mmu05142  Chagas disease
mmu05150  Staphylococcus aureus infection
mmu05171  Coronavirus disease - COVID-19
mmu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    12260 (C1qb)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    12260 (C1qb)
  09171 Infectious disease: bacterial
   05133 Pertussis
    12260 (C1qb)
   05150 Staphylococcus aureus infection
    12260 (C1qb)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    12260 (C1qb)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    12260 (C1qb)
  09164 Neurodegenerative disease
   05020 Prion disease
    12260 (C1qb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    12260 (C1qb)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Phagocytosis
   Opsonins
    12260 (C1qb)
SSDB
Motif
Pfam: C1q Collagen BclA_C
Other DBs
NCBI-GeneID: 12260
NCBI-ProteinID: NP_033907
MGI: 88224
Ensembl: ENSMUSG00000036905
Vega: OTTMUSG00000009766
UniProt: P14106
Position
4 D3; 4 69.05 cM
AA seq 253 aa
MKTQWGEVWTHLLLLLLGFLHVSWAQSSCTGPPGIPGIPGVPGVPGSDGQPGTPGIKGEK
GLPGLAGDLGEFGEKGDPGIPGTPGKVGPKGPVGPKGTPGPSGPRGPKGDSGDYGATQKV
AFSALRTINSPLRPNQVIRFEKVITNANENYEPRNGKFTCKVPGLYYFTYHASSRGNLCV
NLVRGRDRDSMQKVVTFCDYAQNTFQVTTGGVVLKLEQEEVVHLQATDKNSLLGIEGANS
IFTGFLLFPDMDA
NT seq 762 nt   +upstreamnt  +downstreamnt
atgaagacacagtggggtgaggtctggacacacctgttactgctgcttctaggttttctc
catgtgtcctgggcccaaagcagctgcaccgggccccctggcatccctggcatccctggg
gtccctggggttcctggctctgatggccaaccaggcactccagggataaagggggagaaa
gggctccctggactggctggagaccttggtgagtttggagagaaaggggacccagggatc
cctgggactccaggcaaagttggccctaagggtcccgtcggccctaagggtactccaggc
ccctctggaccccgcggtcccaaaggcgattctggggactacggggctacacagaaagtc
gccttctctgccctgaggaccatcaacagccccttgcgaccgaaccaggtcattcgcttc
gaaaaggtgatcaccaacgcgaacgagaactatgagccacgcaacggcaagttcacctgc
aaggtgcctggcctctactacttcacctatcatgccagctcccggggcaacctgtgtgtg
aatctcgttcgtggccgcgatcgggacagcatgcagaaagtagtcaccttctgtgactat
gcccagaacaccttccaggtgaccacaggtggggtagtcttgaagctagagcaagaggag
gttgttcacctgcaggccacagacaagaactccctcctgggcattgagggtgccaacagc
atcttcactggctttctgcttttccctgacatggatgcgtaa

KEGG   Mus musculus (mouse): 12262
Entry
12262             CDS       T01002                                 

Gene name
C1qc, AI385742, Adib, C1qg, Ciqc
Definition
(RefSeq) complement component 1, q subcomponent, C chain
  KO
K03988  complement C1q subcomponent subunit C
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04610  Complement and coagulation cascades
mmu05020  Prion disease
mmu05133  Pertussis
mmu05142  Chagas disease
mmu05150  Staphylococcus aureus infection
mmu05171  Coronavirus disease - COVID-19
mmu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    12262 (C1qc)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    12262 (C1qc)
  09171 Infectious disease: bacterial
   05133 Pertussis
    12262 (C1qc)
   05150 Staphylococcus aureus infection
    12262 (C1qc)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    12262 (C1qc)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    12262 (C1qc)
  09164 Neurodegenerative disease
   05020 Prion disease
    12262 (C1qc)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    12262 (C1qc)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Phagocytosis
   Opsonins
    12262 (C1qc)
SSDB
Motif
Pfam: C1q Collagen BclA_C
Other DBs
NCBI-GeneID: 12262
NCBI-ProteinID: NP_031600
MGI: 88225
Ensembl: ENSMUSG00000036896
Vega: OTTMUSG00000009764
UniProt: Q02105
Position
4 D3; 4 69.05 cM
AA seq 246 aa
MVVGPSCQPPCGLCLLLLFLLALPLRSQASAGCYGIPGMPGMPGAPGKDGHDGLQGPKGE
PGIPAVPGTRGPKGQKGEPGMPGHRGKNGPRGTSGLPGDPGPRGPPGEPGVEGRYKQKHQ
SVFTVTRQTTQYPEANALVRFNSVVTNPQGHYNPSTGKFTCEVPGLYYFVYYTSHTANLC
VHLNLNLARVASFCDHMFNSKQVSSGGVLLRLQRGDEVWLSVNDYNGMVGIEGSNSVFSG
FLLFPD
NT seq 741 nt   +upstreamnt  +downstreamnt
atggtcgttggacccagttgccagcctccatgtggactttgcctgctgctgctgtttctt
ctggccctaccactcaggagccaggccagcgctggctgctatgggatcccagggatgcca
ggcatgccgggggcccctgggaaggacgggcatgatggactccaggggcccaagggagag
ccaggaatcccagccgtccctgggacccgaggacccaagggtcagaagggcgagcctggc
atgcctggccaccgtgggaaaaatggccccagggggacctcagggttgccaggggaccca
ggccccagggggcctccgggggagccaggtgtggagggccgatacaaacagaagcaccag
tcggtattcacagtcacccggcagaccacccagtacccagaggccaacgccctcgtcagg
ttcaactctgtggtcaccaaccctcaggggcattacaacccaagcacagggaagttcacc
tgtgaagtgccgggcctctactacttcgtctactacacatcgcatacggccaacctgtgc
gtgcacctgaacctcaaccttgccagggtggccagcttctgcgaccacatgttcaacagc
aagcaggtcagctccggaggagtcctcctgcggctccagaggggcgatgaggtgtggcta
tcagtcaatgactacaatggcatggtgggcatagagggctccaacagcgtcttctctggt
ttcctactgtttcccgactag

KEGG   Mus musculus (mouse): 317677
Entry
317677            CDS       T01002                                 

Gene name
C1s2, C1sb, EG317677, Gm5077
Definition
(RefSeq) complement component 1, s subcomponent 2
  KO
K01331  complement component 1, s subcomponent [EC:3.4.21.42]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04610  Complement and coagulation cascades
mmu05133  Pertussis
mmu05150  Staphylococcus aureus infection
mmu05171  Coronavirus disease - COVID-19
mmu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    317677 (C1s2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    317677 (C1s2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    317677 (C1s2)
   05150 Staphylococcus aureus infection
    317677 (C1s2)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    317677 (C1s2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    317677 (C1s2)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    317677 (C1s2)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.42  complement subcomponent C_overbar_1s_
     317677 (C1s2)
Peptidases and inhibitors [BR:mmu01002]
 Serine peptidases
  Family S1: chymotrypsin family
   317677 (C1s2)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Phagocytosis
   Opsonins
    317677 (C1s2)
SSDB
Motif
Pfam: Trypsin CUB Sushi FXa_inhibition EGF_CA CUB_2 Trypsin_2 EGF hEGF HRM
Other DBs
NCBI-GeneID: 317677
NCBI-ProteinID: NP_776289
MGI: 3644269
Ensembl: ENSMUSG00000079343
Vega: OTTMUSG00000028980
UniProt: Q8CFG8 A0A1W2P7F1
Position
6; 6 F2
AA seq 694 aa
MGKSPGMWYLVLFSLLASFSAEPTMHGEILSPNYPQAYPNDVVKSWDIEVPEGFGIHLYF
THVDIEPSESCAYDSVQIISGGIEEGRLCGQRTSKSPNSPIIEEFQFPYNKLQVVFTSDF
SIEEQFTGFAAYYTAIDVNECTDFTDVPCSHFCNNFIGGYFCSCPPEYFLHDDMRNCGVN
CSGDVFTALIGEISSPNYPNPYPENSRCEYQIQLQEGFQVVVTMQREDFDVEPADSEGNC
PDSLTFAAKNQQFGPYCGDGFPGPLTIRTQSNTLGIVFQTDLMGQKKGWKLRYHGDPISC
PKESTANSNWEPDKAKYVFKDVVKITCVDGFEVVEGHVSSTSYYSTCQSDGQWSNSGLKC
QPVYCGIPDPIANGKVEEPENSVFGTVIHYTCEEPYYYMEHEEGGEYRCAANGRWVNDQL
GIELPRCIPVCGVPTEPFQVQQKIFGGQPAKIENFPWQVFFNHPTAGGALINEYWVLTAA
HVVEKNSDPSMYAGITALRLADLENAQRLYTKRVIIHPGWKEDDDLNPRTNFDNDIALVQ
LKDPVKMGPKFSPICLPGTSSEYNLSPGDMGLISGWGRTEKRLHVINLRGAKVPVTSLET
CKQVKEENPTARPEDYVITDNMICAGEKGVDSCKGDSGGAFAFQVPNVKAPKFYVAGLVS
WGKKCGAYGVYTKVKNYVDWILKTMQENSGPRKD
NT seq 2085 nt   +upstreamnt  +downstreamnt
atgggcaaatcgccagggatgtggtatttggtcctgttttctcttttggcatcattttct
gctgagcccaccatgcatggggagatcctgtcccctaactatccccaggcgtaccccaat
gacgtcgtgaaatcttgggacattgaagtcccagaggggtttgggattcacctttacttt
acccatgtggacatagagccgtcagagagctgtgcatacgactcagtgcagataatctca
ggaggcatcgaggaagggagactctgtggtcagaggaccagcaagagccccaactccccc
attatagaagagtttcagttcccatacaataaacttcaggtggtctttacctcagacttc
tccatcgaagaacagtttaccggctttgcagcatactacactgccatagacgtaaacgaa
tgcacagattttacagatgtcccctgtagccacttctgcaataacttcattggtggatac
ttctgctcctgtcccccagaatacttcctccatgatgacatgaggaattgtggagtcaac
tgtagtggagatgtgttcactgccctgattggggagatctcaagtcccaattatcccaat
ccatacccggagaactcaaggtgtgaataccagattcaactgcaggagggcttccaagtg
gtggtgacgatgcagagagaagattttgatgtggagcccgctgactcagaggggaactgc
cctgacagtttaacttttgctgcaaaaaaccaacagtttggtccttactgtggcgatggg
tttcctggaccgctaactattagaacccagagcaatactctcggcattgtctttcaaact
gatctaatggggcaaaaaaagggttggaagcttcgttaccatggagatcccatctcctgt
cctaaagaaagcactgccaattctaattgggagcccgataaggcaaaatacgtgtttaaa
gatgtggtgaagataacctgtgtggacggatttgaagttgtggagggacatgttagctct
acttcatactattccacttgtcaaagcgatggacagtggagcaactccggtctaaaatgt
caacctgtgtattgtggaattccagatcccattgcgaatggtaaagttgaagagccagag
aatagtgtgtttggtactgtcattcactatacgtgtgaagagccatattactacatggaa
catgaagaaggtggggagtatcgatgtgctgcaaatgggagatgggtaaatgaccagctg
ggtattgagcttccaagatgtattccagtctgtggagtacccaccgagccctttcaagtg
cagcagaagatattcggaggacaacctgcaaagattgaaaattttccctggcaagtcttc
tttaatcaccccacagctggtggggctcttattaatgagtactgggtgctgacggccgct
cacgttgtggagaaaaactccgacccttcaatgtatgccgggatcacggctttgagactg
gctgacttggaaaatgcccagaggctctacaccaagcgtgtgattattcatcccggctgg
aaggaagacgatgacctaaacccacggacaaattttgacaatgacattgccctggtccag
ctgaaagaccctgtgaaaatgggacccaagttttcccccatctgcctaccaggcacctcc
tcagagtacaacctctcaccgggtgacatggggctgatctcagggtggggcagaacagaa
aagagactccatgttatcaacctcagaggggcaaaggtaccggtaacctctttagaaacc
tgcaaacaggtgaaagaagagaaccccacagcaaggccagaggactatgttatcactgac
aacatgatctgtgctggtgagaagggtgttgacagctgtaaaggggacagtggaggggct
tttgctttccaggtccccaatgtcaaggccccaaaattctatgtagctgggttggtgtct
tggggaaaaaagtgtggggcctatggggtctacacaaaggtaaagaattatgtggactgg
atcctgaaaactatgcaggagaatagtgggcccaggaaggactaa

KEGG   Mus musculus (mouse): 50908
Entry
50908             CDS       T01002                                 

Gene name
C1s1, AA959438, AI255193, AI327365, C1, C1s, C1sa
Definition
(RefSeq) complement component 1, s subcomponent 1
  KO
K01331  complement component 1, s subcomponent [EC:3.4.21.42]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04610  Complement and coagulation cascades
mmu05133  Pertussis
mmu05150  Staphylococcus aureus infection
mmu05171  Coronavirus disease - COVID-19
mmu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    50908 (C1s1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    50908 (C1s1)
  09171 Infectious disease: bacterial
   05133 Pertussis
    50908 (C1s1)
   05150 Staphylococcus aureus infection
    50908 (C1s1)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    50908 (C1s1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    50908 (C1s1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    50908 (C1s1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.42  complement subcomponent C_overbar_1s_
     50908 (C1s1)
Peptidases and inhibitors [BR:mmu01002]
 Serine peptidases
  Family S1: chymotrypsin family
   50908 (C1s1)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Phagocytosis
   Opsonins
    50908 (C1s1)
SSDB
Motif
Pfam: Trypsin CUB Sushi FXa_inhibition EGF_CA CUB_2 Trypsin_2 EGF hEGF HRM
Other DBs
NCBI-GeneID: 50908
NCBI-ProteinID: NP_001091086
MGI: 1355312
Ensembl: ENSMUSG00000038521
Vega: OTTMUSG00000034941
UniProt: Q8CG14 E9Q6C2 Q14DT6
Position
6; 6 F2
AA seq 694 aa
MGKSPGMWCLVLFSLLASFSAEPTMHGEILSPNYPQAYPNDVVKSWDIEVPEGFGIHLYF
THVDIEPSESCAYDSVQIISGDIEEGRLCGQRTSKSPNSPIIEEFQFPYNKLQVVFTSDF
SNEERFTGFAAYYTAIDINECTDFTDVPCSHFCNNFIGGYFCSCPPEYFLHDDMRNCGVN
CSGDVFTALIGEISSPNYPNPYPENSRCEYQIQLQEGFQVVVTMQREDFDVEPADSEGNC
PDSLTFASKNQQFGPYCGNGFPGPLTIRTQSNTLGIVFQTDLMGQKKGWKLRYHGDPISC
AKKITANSTWQPDKAKYVFKDVVKITCVDGFEVVEGHVSSTSYYSTCQSDGQWSNSGLKC
QPVYCGIPDPIANGKVEEPENSVFGTVVHYTCEEPYYYMEHEEGGEYRCAANGRWVNDQL
GIELPRCIPACGVPTEPFQVHQRIFGGQPAKIENFPWQVFFNHPRASGALINEYWVLTAA
HVLEKISDPLMYVGTMSVRTTLLENAQRLYSKRVFIHPSWKKEDDPNTRTNFDNDIALVQ
LKDPVKMGPKVSPICLPGTSSEYNVSPGDMGLISGWGSTEKKVFVINLRGAKVPVTSLET
CKQVKEENPTVRPEDYVFTDNMICAGEKGVDSCHGDSGGAFAFQVPNVTVPKFYVAGLVS
WGKRCGTYGVYTKVKNYVDWILKTMQENSGPRKD
NT seq 2085 nt   +upstreamnt  +downstreamnt
atgggcaaatcgccagggatgtggtgtttggtcctgttttctcttttggcatcattttct
gctgagcccaccatgcatggggagatcctgtcccctaattatccccaggcgtaccccaat
gacgtcgtgaaatcttgggacattgaagtcccagaggggtttgggattcacctttacttt
acccatgtggacatagagccgtcagagagctgtgcatacgactcagtgcagataatctca
ggagacatcgaggaagggagactctgtggccagaggaccagcaagagccccaactccccc
attatagaagagtttcagttcccatacaataaacttcaggtggtctttacctcagacttc
tccaacgaagaacggtttacgggctttgcagcatactacactgccatagacataaatgaa
tgcacagattttacagatgtcccctgtagccacttctgcaataacttcattggtggatac
ttctgctcctgtcccccagaatacttcctccacgatgacatgaggaattgtggagtcaac
tgtagtggagatgtgttcactgccctgattggggagatctcaagtcccaattatcccaat
ccatacccggagaactcaaggtgtgaataccagattcagctgcaggagggcttccaagtg
gtggtgacgatgcagagagaagattttgatgtggagcccgctgactcagaggggaactgc
cctgacagtttaacttttgcttcaaaaaaccaacagtttggtccttactgtggtaatggg
ttccctggaccgctaactattagaacccagagcaatactctcggcattgtctttcaaact
gacctaatggggcaaaagaagggttggaagcttcgttaccatggagatcccatctcctgt
gccaaaaaaatcactgccaattctacttggcagcccgataaggcaaaatacgtgtttaaa
gatgtggtgaagataacctgtgtggacggatttgaagttgtggagggacatgttagctct
acttcatactattccacttgtcaaagcgatggacagtggagcaactccggtctaaaatgt
caacctgtgtattgtggaattccagatcccattgcgaatggtaaagttgaagagccagag
aatagtgtgtttggtactgttgttcactacacgtgtgaagagccatattactacatggaa
catgaagaaggtggggagtatcgatgtgctgcaaatgggagatgggtaaatgaccagctg
ggtattgagcttccaagatgtattccagcctgtggagtacccaccgagccctttcaagtg
catcagaggatatttggaggacaacctgcaaagattgaaaattttccctggcaagtcttc
tttaatcaccccagagctagtggggctcttattaatgagtactgggtgctgacggctgct
cacgttttggagaaaatctccgaccctttaatgtatgtcgggaccatgtctgtgaggaca
actctcttggaaaatgcccagagactctacagtaaacgtgtctttattcatcccagctgg
aagaaagaagatgacccaaacacacggacaaattttgacaatgacattgccctggtgcag
ctgaaagaccctgtgaaaatgggacccaaagtctcccccatctgcctaccaggcacctcc
tcagagtacaacgtctcaccgggtgacatggggctgatctcagggtggggcagtacagaa
aagaaagtctttgttatcaacctcagaggggcaaaggtaccagtaacctctttagaaacc
tgcaaacaggtgaaagaggagaaccccactgtaaggcctgaggactatgttttcactgac
aacatgatctgtgctggcgagaaaggtgttgacagctgtcacggggacagcggcggggct
tttgctttccaggtccccaatgtcacggtccccaaattctatgtagctggcttggtgtct
tgggggaaaaggtgtgggacttatggggtctacacaaaggtaaagaattacgtggactgg
atcctgaaaactatgcaggagaatagtgggcccaggaaggactaa

KEGG   Mus musculus (mouse): 50909
Entry
50909             CDS       T01002                                 

Gene name
C1ra, AI132558, C1r, mC1, mC1rA
Definition
(RefSeq) complement component 1, r subcomponent A
  KO
K01330  complement component 1, r subcomponent [EC:3.4.21.41]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04145  Phagosome
mmu04610  Complement and coagulation cascades
mmu05133  Pertussis
mmu05150  Staphylococcus aureus infection
mmu05171  Coronavirus disease - COVID-19
mmu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    50909 (C1ra)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    50909 (C1ra)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    50909 (C1ra)
  09171 Infectious disease: bacterial
   05133 Pertussis
    50909 (C1ra)
   05150 Staphylococcus aureus infection
    50909 (C1ra)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    50909 (C1ra)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    50909 (C1ra)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    50909 (C1ra)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.41  complement subcomponent C_overbar_1r_
     50909 (C1ra)
Peptidases and inhibitors [BR:mmu01002]
 Serine peptidases
  Family S1: chymotrypsin family
   50909 (C1ra)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Phagocytosis
   Opsonins
    50909 (C1ra)
SSDB
Motif
Pfam: Trypsin CUB Sushi FXa_inhibition cEGF EGF_CA EGF hEGF
Other DBs
NCBI-GeneID: 50909
NCBI-ProteinID: NP_075632
MGI: 1355313
Ensembl: ENSMUSG00000055172
Vega: OTTMUSG00000056669
UniProt: Q8CG16 Q9CTX0
Position
6; 6 F2
AA seq 707 aa
MWLFALLVTLFYGVEGSIYLPQKLYGEVTSPLYPKPYPSDLETTTVITVPMGYRVKLVFW
QFDVEPSEGCFYDYVKISADKQTLGRFCGQLDSPLGNPPGSKEFMSQGNKMLLTFHTDFS
NEENGTIMFYKGFLAYYQAVDLDECASQPNSVEEGLQPRCQHLCHNYVGGYFCSCHPGYE
LQKDGQSCQAECSSELYTEPSGYVSSLEYPQPYPPDLRCNYSIRVERGLTVHLKFLDPFE
IDDHQQVHCPYDQLQIYANGKNLGEFCGKQRPPDLDTSSNAVDLLFFTDESGDSRGWKLH
YTTETIKCPQPKALDEFTIIQDPQPQYQFRDYFIVTCKQGYQLMEGNQALLSFTAVCQND
GTWHRAMPRCKIKNCGQPQSLSNGDFRYITTKGVTTYEASIQYHCHEPYYKMLTRAGSSE
SMRGIYTCTAQGIWKNEEEGEKMPRCLPVCGKPVNPVTQKERIIRGQPARPGNFPWQAFT
TTHGRGGGALLGDRWILTAAHTIYPKHHNKENDNANPKMLVFLGHTNVEQIKKLGHHPVR
RVIIHPDYRQDEPNNFEGDIALLELENSVTLGPELLPICLPDNETFYGQGLMGYVSGFGI
TEDKLAFDLRFVRLPVADSEACQRWLQTKKDTSPFSQNMFCSGDPAVQQDACQGDSGGVF
AVRDRNRDIWVATGIVSWGIGCGEGYGFYTKVLNYVDWIKKEMGDEN
NT seq 2124 nt   +upstreamnt  +downstreamnt
atgtggctctttgccctcctggtgaccctgttctatggggtggaaggctccatttacctc
cctcagaagctctatggagaggtgacctcccctctgtatcccaagccttaccccagtgac
ttggagacaaccactgtgatcactgtccccatggggtacagggtgaagctggtcttctgg
cagtttgacgtggagccttctgaaggctgcttctatgactatgttaagatttctgctgat
aagcaaacactggggaggttctgtgggcagctggattctcccctgggcaaccccccagga
agcaaggaattcatgtcccaaggaaacaagatgctgctgaccttccacacagacttctcc
aatgaggagaatgggaccatcatgttctacaagggcttcctggcctactaccaggctgta
gaccttgatgaatgtgcatcgcagcccaactcagtggaagagggtttgcagccccgatgc
caacatctgtgtcacaactatgttggaggctacttctgttcctgccatcctggctatgag
cttcagaaagatgggcaatcctgccaggctgagtgcagcagtgagctctacacagagccc
tcaggctatgtctccagccttgaataccctcagccctatccaccggatctacgctgcaac
tacagcatccgggtggagaggggcctcactgtgcacctcaagttcctggatccttttgaa
attgatgaccaccagcaagtgcactgcccctatgaccagctccagatctacgctaatggg
aagaacttgggtgaattctgtggaaagcaaaggcctccagaccttgacaccagcagcaat
gcagtggatctgctgttcttcacagatgagtcaggggacagccgaggctggaagctgcac
tacaccactgaaaccatcaagtgcccccagcccaaggctctggatgagttcaccatcatc
caggatccgcagcctcagtaccagttccgggattacttcattgtcacctgcaagcaaggc
taccagctcatggagggaaatcaggcgctactctccttcacagctgtttgccagaatgat
ggcacatggcatcgtgccatgcccaggtgcaagatcaagaactgtgggcagccccaaagc
ctgtctaatggggacttccgctacatcaccacaaaaggcgtgaccacctatgaagccagt
atccagtatcactgccatgaaccatattacaagatgctgaccagagctggcagcagcgag
tccatgcgagggatatatacctgcacagcccaaggcatttggaagaatgaagaggaagga
gagaaaatgccccggtgtctgccagtgtgtgggaaacctgtcaaccctgtgacacagaag
gagcgcatcatcagagggcagccagccaggcccggcaacttcccctggcaggccttcacc
actacccacgggcgagggggtggggccctgcttggagaccgctggatcctcacagcagcc
cacaccatctaccccaagcatcacaacaaggaaaacgacaatgccaaccccaaaatgctt
gttttcctgggccacacaaatgtggaacagatcaaaaaactgggacatcacccagtccgt
agggtcatcatacacccagactaccgccaagatgaacctaacaattttgaaggagacatt
gctctactggagctggaaaacagtgtcacactgggccccgaactcctccccatctgtctc
ccagacaatgagaccttctatggccaaggcctcatgggttatgtcagcggattcgggata
acagaagataagttagctttcgatctcaggttcgtcagactgcctgtagctgacagtgag
gcatgccagagatggctccagacaaaaaaggatacttctccattttctcaaaatatgttc
tgttctggggacccagctgtacagcaagacgcctgccaaggggacagtgggggtgttttt
gcagtcagggacagaaatcgtgatatttgggtggctacgggcatcgtatcctggggcatt
gggtgtggtgagggatatggcttctacaccaaggtactgaattatgttgactggatcaag
aaagagatgggagacgaaaactga

KEGG   Mus musculus (mouse): 667277
Entry
667277            CDS       T01002                                 

Gene name
C1rb, Gm8551, mC1r, mC1rB
Definition
(RefSeq) complement component 1, r subcomponent B
  KO
K01330  complement component 1, r subcomponent [EC:3.4.21.41]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04145  Phagosome
mmu04610  Complement and coagulation cascades
mmu05133  Pertussis
mmu05150  Staphylococcus aureus infection
mmu05171  Coronavirus disease - COVID-19
mmu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    667277 (C1rb)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    667277 (C1rb)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    667277 (C1rb)
  09171 Infectious disease: bacterial
   05133 Pertussis
    667277 (C1rb)
   05150 Staphylococcus aureus infection
    667277 (C1rb)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    667277 (C1rb)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    667277 (C1rb)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    667277 (C1rb)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.41  complement subcomponent C_overbar_1r_
     667277 (C1rb)
Peptidases and inhibitors [BR:mmu01002]
 Serine peptidases
  Family S1: chymotrypsin family
   667277 (C1rb)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Phagocytosis
   Opsonins
    667277 (C1rb)
SSDB
Motif
Pfam: Trypsin CUB Sushi FXa_inhibition cEGF EGF_CA EGF hEGF
Other DBs
NCBI-GeneID: 667277
NCBI-ProteinID: NP_001106827
MGI: 3779804
Ensembl: ENSMUSG00000098470
Vega: OTTMUSG00000044915
UniProt: Q8CFG9
Position
6 F2; 6
AA seq 706 aa
MWLFALLVTLFYGVEGSIYLPQKLYGEVTSPLYPKPYPSDLETTTVITVPMGYRVKLVFW
QFDVEPSEGCLYDYVKISADKQTLGRFCGQLDSPLGNPPGSKEFMSQGNKMLLTFHTDFS
NEENGTIMFYKGFLAYYQAVDLDECASQPNSVEEGLQPRCQHLCHNYVGGYFCSCHPGYE
LQKDGQSCQAECSSELYTEPSGYVSSLEYPQPYPPDLRCNYSIRVERGLTVHLKFLDPFE
IDDHQQVHCPYDQLQIYANGKNLGEFCGKQRPPDLDTSSNAVDLLFFTDESGDSRGWKLH
YTTETIKCPQPKALDEFTIIQDPQPQYQFRDYFTVTCKQGYQLMEGNQALLSFTAVCQHD
GTWHRAMPRCKIKNCGQPQSLSNGDFRYITTKGVTTYEASIQYHCHEPYYKMLTRAGSSE
SMRGIYTCTAQGIWKNEEEGEKMPRCLPVCGKPVNPVTQKERIIGGQPARPGNFPWQAFT
TIYGPGGGALLGDRWILTAAHTIYPKYPNKGKNTNPRTLVFLGHTNMEQIQKLGHHPVRR
VIIHPDYRQEEPDNFEGDIALLELENSVTLGPELLPICLPDNETFYGQGLMGYVSGFGTT
GNRIPFHLRFVRLPVADREACQRWLWTKKDTSPFSQNMFCSGDPAVQQDACQGDSGGVFA
VRDRNRDIWVATGIVSWGIGCGEGYGFYTKVLNYVDWIKKEMGDEN
NT seq 2121 nt   +upstreamnt  +downstreamnt
atgtggctctttgccctcctggtgaccctgttctatggggtggaaggctccatctacctc
cctcagaagctctatggagaggtgacctcccctctgtatcccaagccttaccccagtgac
ttggagacaaccactgtgatcactgtccccatggggtacagggtgaagctggtcttctgg
cagtttgacgtggagccttctgaaggctgcctctatgactatgttaagatttctgctgat
aagcaaacactggggaggttctgtgggcagctggattctcccctgggcaaccccccagga
agcaaggaattcatgtcccaaggaaacaagatgctgctgaccttccacacagacttctcc
aatgaggagaatgggaccatcatgttctacaagggcttcctggcctactaccaggctgta
gaccttgatgaatgtgcatcgcagcccaactcagtggaagagggtttgcagccccgatgc
caacatctgtgtcacaactatgttggaggctacttctgttcctgccatcctggctatgag
cttcagaaagatgggcaatcctgccaggctgagtgcagcagtgagctctacacagagccc
tcaggctatgtctccagccttgaataccctcagccctatccaccggatctacgctgcaac
tacagcatccgggtggagaggggcctcactgtgcacctcaagttcctggatccttttgaa
attgatgaccaccagcaagtgcactgcccctatgaccagctccagatctacgctaatggg
aagaacttgggtgaattctgtggaaagcaaaggcctccagaccttgacaccagcagcaat
gcagtggatctgctgttcttcacagatgagtcaggggacagccgaggctggaagctgcac
tacaccactgaaaccatcaagtgcccccagcccaaggctctggatgagttcaccatcatc
caggatccacagcctcagtaccagttccgggattacttcactgtcacctgcaagcaaggc
taccagctcatggagggaaatcaggcgctactgtccttcacagctgtttgccagcatgat
ggcacgtggcatcgtgccatgcccaggtgcaagatcaagaactgtgggcagccccaaagc
ctgtctaatggggacttccgctacatcaccacaaaaggtgtgaccacctatgaagccagt
atccagtatcactgccatgaaccatattacaagatgctgaccagagctggcagcagcgag
tccatgcgagggatatatacctgcacagcccaaggcatttggaagaatgaagaggaagga
gagaaaatgccccggtgtctgccagtgtgtgggaaacctgtcaaccctgtgacacagaag
gagcgcatcattggagggcagccagccaggcccggcaacttcccctggcaggccttcacc
actatctatgggccagggggtggggccctgcttggagaccgctggatcctcacagcagcc
cacaccatctaccccaagtatcccaacaaaggaaaaaacaccaaccccagaacgcttgtt
ttcctgggccacacaaacatggaacagatccaaaaactgggacatcacccagtccgtagg
gtcatcatacacccagactaccgccaagaagaacctgacaattttgaaggagacattgct
ctactggagctggaaaacagtgtcacactgggccccgaactcctccccatctgtctccca
gacaatgagaccttctatggccaaggcctcatgggttatgtcagcggattcgggacaaca
ggaaataggatacctttccatctcaggtttgtcagactgcctgtagctgatcgagaggca
tgccagagatggctctggacaaaaaaggatacttctccattttctcaaaatatgttctgt
tctggggacccagctgtacagcaagacgcctgccagggggacagtgggggtgtttttgca
gtcagggacagaaatcgtgatatctgggtggctacgggcatcgtatcctggggcattggg
tgtggtgagggatatggcttctacaccaaggtactgaattatgttgactggatcaagaaa
gagatgggagacgaaaactga

DBGET integrated database retrieval system