KEGG   Mus musculus (mouse): 12263
Entry
12263             CDS       T01002                                 

Gene name
C2
Definition
(RefSeq) complement component 2 (within H-2S)
  KO
K01332  complement component 2 [EC:3.4.21.43]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04610  Complement and coagulation cascades
mmu05133  Pertussis
mmu05150  Staphylococcus aureus infection
mmu05171  Coronavirus disease - COVID-19
mmu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    12263 (C2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    12263 (C2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    12263 (C2)
   05150 Staphylococcus aureus infection
    12263 (C2)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    12263 (C2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    12263 (C2)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.43  classical-complement-pathway C3/C5 convertase
     12263 (C2)
Peptidases and inhibitors [BR:mmu01002]
 Serine peptidases
  Family S1: chymotrypsin family
   12263 (C2)
SSDB
Motif
Pfam: VWA Trypsin Sushi VWA_2 DUF1986 HRM Trypsin_2
Other DBs
NCBI-GeneID: 12263
NCBI-ProteinID: NP_038512
MGI: 88226
Ensembl: ENSMUSG00000024371
Vega: OTTMUSG00000034003
UniProt: P21180
Position
17 B1; 17 18.41 cM
AA seq 760 aa
MAPLLALFYLLQLGPGLAALFCNQNVNITGGNFTLSHGWAPGSLLIYSCPLGRYPSPAWR
KCQSNGQWLTPRSSSHHTLRSSRMVKAVCKPVRCLAPSSFENGIYFPRLVSYPVGSNVSF
ECEQDFTLRGSPVRYCRPNGLWDGETAVCDNGASHCPNPGISVGTARTGLNFDLGDKVRY
RCSSSNMVLTGSAERECQSNGVWSGSEPICRQPYSYDFPEDVASALDTSLTNLLGATNPT
QNLLTKSLGRKIIIQRSGHLNLYLLLDASQSVTEKDFDIFKKSAELMVERIFSFEVNVSV
AIITFASQPKTIMSILSERSQDVTEVITSLDSASYKDHENATGTNTYEVLIRVYSMMQSQ
MDRLGMETSAWKEIRHTIILLTDGKSNMGDSPKKAVTRIRELLSIEQNRDDYLDIYAIGV
GKLDVDWKELNELGSKKDGERHAFILQDAKALQQIFEHMLDVSKLTDTICGVGNMSANAS
DQERTPWQVTFKPKSKETCQGSLISDQWVLTAAHCFHDIQMEDHHLWRVNVGDPTSQHGK
EFLVEDVIIAPGFNVHAKRKQGISEFYADDIALLKLSRKVKMSTHARPICLPCTVGANMA
LRRSPGSTCKDHETELLSQQKVPAHFVALNGNRLNINLRTGPEWTRCIQAVSQNKNIFPS
LTNVSEVVTDQFLCSGMEEEDDNPCKGESGGAVFLGRRYRFFQVGLVSWGLFDPCHGSSN
KNLRKKPPRGVLPRDFHISLFRLQPWLRQHLDGVLDFLPL
NT seq 2283 nt   +upstreamnt  +downstreamnt
atggcccctctgctggctctcttctacctgctgcagctgggcccaggcctggctgctctc
ttctgcaaccagaatgtcaatatcaccggtggtaatttcaccctcagccatggctgggcc
cctgggagcctcctcatctactcctgccccctgggcaggtacccgtccccagcctggagg
aaatgtcagagcaacggacagtggctgacaccaaggtctagctcacatcacaccctgcga
tcctctcggatggttaaagcagtctgcaaaccggttcgatgcctagctccttcatccttt
gaaaatggcatctatttccctcggctggtgtcctaccctgtgggtagcaacgtgagcttt
gagtgtgagcaagacttcaccttgcggggctcacctgtgcggtactgtcgccccaacggc
ctgtgggatggagagacggctgtgtgtgacaatggggctagccactgccccaaccctggc
atctcagtgggcacagctcggacaggcttgaactttgaccttggggacaaggtcaggtac
cgctgctcctcctcaaatatggtattgactggctctgcagagcgggagtgtcagagcaat
ggagtgtggagtgggtcggaacccatttgccgacagccttactcttacgacttccctgag
gatgtagcatctgccctagacacctccctcaccaacctgcttggagccaccaatcccacc
cagaaccttctgacaaaaagtttgggccgtaagatcataatccagcgctcgggtcacctg
aacctctatttgctgcttgatgcttctcagagtgtgacagaaaaagactttgacatcttc
aagaagagtgccgaactcatggtggagaggatcttcagctttgaggtaaatgtcagcgta
gctatcatcacctttgcctctcagcccaaaaccatcatgtcgatcctgagtgagagatcc
caggatgtgacggaggtgatcaccagtctggactctgccagctacaaagatcacgaaaat
gccactggcactaacacttatgaggttctcatccgcgtttactccatgatgcaaagccag
atggatcgcctgggcatggagacctctgcctggaaggaaatccgtcacaccatcatcctt
ctgactgacggaaagtccaacatgggtgactctcccaagaaagcagtcaccagaatcaga
gagctcctgagcatcgaacagaacagagatgactacctggacatctatgctattggggtg
ggcaagctggatgtggactggaaagaactgaatgagctgggttccaagaaggatggcgag
aggcatgccttcatcttgcaggatgcaaaggccttgcaacagatctttgagcacatgttg
gatgtctctaagctcacagataccatctgtggggtggggaacatgtccgccaatgcctct
gaccaggagaggacaccttggcaagtcacctttaagcccaagagcaaggaaacttgccag
ggatcactcatctctgatcagtgggtgctgacagcagctcactgcttccatgacattcag
atggaggaccaccacctgtggagggtcaatgtaggtgatcccacctctcagcatggcaaa
gaatttcttgtggaggacgtgataattgccccagggtttaatgtccatgcaaagcggaag
cagggcatctcagagttctatgctgatgacattgccttgctgaagctatctcggaaagtg
aaaatgtccacccatgccagacccatctgccttccttgcactgtgggagccaacatggct
ctgcggagatccccaggtagtacctgtaaagatcatgagacagaacttctgtcacagcag
aaagttcctgcacattttgtagctttgaatgggaacagactcaacatcaacctcaggaca
ggacctgagtggacaaggtgtatccaggctgtctcccaaaacaaaaacatcttccccagc
ttgacaaacgttagcgaggtggtgacagaccagttcctatgcagtgggatggaggaggaa
gatgacaatccttgcaaaggagaatctgggggagccgttttccttggacggagatacagg
ttcttccaggtgggcctggtgagttggggtctttttgacccttgtcatggttcctccaac
aaaaacttgcgcaagaaacctccacgtggtgttctgccaagggacttccacattagtctt
ttccgcctgcagccctggctgaggcagcacctggatggtgtcctggactttctgccactt
taa

DBGET integrated database retrieval system