KEGG   Mus musculus (mouse): 12268Help
Entry
12268             CDS       T01002                                 

Gene name
C4b, C4, Ss
Definition
(RefSeq) complement component 4B (Chido blood group)
  KO
K03989  complement component 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04610  Complement and coagulation cascades
mmu05133  Pertussis
mmu05150  Staphylococcus aureus infection
mmu05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    12268 (C4b)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    12268 (C4b)
  09171 Infectious disease: bacterial
   05133 Pertussis
    12268 (C4b)
   05150 Staphylococcus aureus infection
    12268 (C4b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    12268 (C4b)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    12268 (C4b)
Peptidases and inhibitors [BR:mmu01002]
 Peptidase inhibitors
  Family I39: alpha2M family
   12268 (C4b)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   12268 (C4b)
  Exosomal proteins of other cancer cells
   12268 (C4b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TED_complement A2M A2M_recep A2M_BRD NTR MG2 MG3 ANATO MG4 RAB3GAP2_C
Motif
Other DBs
NCBI-GeneID: 12268
NCBI-ProteinID: NP_033910
MGI: 88228
Ensembl: ENSMUSG00000073418
Vega: OTTMUSG00000037255
UniProt: P01029 Q3TYN1
Position
17 B1; 17 18.29 cM
AA seq 1738 aa AA seqDB search
MRLLWGLAWVFSFCASSLQKPRLLLFSPSVVNLGTPLSVGVQLLDAPPGQEVKGSVFLRN
PKGGSCSPKKDFKLSSGDDFVLLSLEVPLEDVRSCGLFDLRRAPHIQLVAQSPWLRNTAF
KATETQGVNLLFSSRRGHIFVQTDQPIYNPGQRVRYRVFALDQKMRPSTDFLTITVENSH
GLRVLKKEIFTSTSIFQDAFTIPDISEPGTWKISARFSDGLESNRSTHFEVKKYVLPNFE
VKITPWKPYILMVPSNSDEIQLDIQARYIYGKPVQGVAYTRFALMDEQGKRTFLRGLETQ
AKLVEGRTHISISKDQFQAALDKINIGVRDLEGLRLYAATAVIESPGGEMEEAELTSWRF
VSSAFSLDLSRTKRHLVPGAHFLLQALVQEMSGSEASNVPVKVSATLVSGSDSQVLDIQQ
STNGIGQVSISFPIPPTVTELRLLVSAGSLYPAIARLTVQAPPSRGTGFLSIEPLDPRSP
SVGDTFILNLQPVGIPAPTFSHYYYMIISRGQIMAMGREPRKTVTSVSVLVDHQLAPSFY
FVAYFYHQGHPVANSLLINIQSRDCEGKLQLKVDGAKEYRNADMMKLRIQTDSKALVALG
AVDMALYAVGGRSHKPLDMSKVFEVINSYNVGCGPGGGDDALQVFQDAGLAFSDGDRLTQ
TREDLSCPKEKKSRQKRNVNFQKAVSEKLGQYSSPDAKRCCQDGMTKLPMKRTCEQRAAR
VPQQACREPFLSCCKFAEDLRRNQTRSQAHLARNNHNMLQEEDLIDEDDILVRTSFPENW
LWRVEPVDSSKLLTVWLPDSMTTWEIHGVSLSKSKGLCVAKPTRVRVFRKFHLHLRLPIS
IRRFEQFELRPVLYNYLNDDVAVSVHVTPVEGLCLAGGGMMAQQVTVPAGSARPVAFSVV
PTAAANVPLKVVARGVFDLGDAVSKILQIEKEGAIHREELVYNLDPLNNLGRTLEIPGSS
DPNIVPDGDFSSLVRVTASEPLETMGSEGALSPGGVASLLRLPQGCAEQTMIYLAPTLTA
SNYLDRTEQWSKLSPETKDHAVDLIQKGYMRIQQFRKNDGSFGAWLHRDSSTWLTAFVLK
ILSLAQEQVGNSPEKLQETASWLLAQQLGDGSFHDPCPVIHRAMQGGLVGSDETVALTAF
VVIALHHGLDVFQDDDAKQLKNRVEASITKANSFLGQKASAGLLGAHAAAITAYALTLTK
ASEDLRNVAHNSLMAMAEETGEHLYWGLVLGSQDKVVLRPTAPRSPTEPVPQAPALWIET
TAYALLHLLLREGKGKMADKAASWLTHQGSFHGAFRSTQDTVVTLDALSAYWIASHTTEE
KALNVTLSSMGRNGLKTHGLHLNNHQVKGLEEELKFSLGSTISVKVEGNSKGTLKILRTY
NVLDMKNTTCQDLQIEVKVTGAVEYAWDANEDYEDYYDMPAADDPSVPLQPVTPLQLFEG
RRSRRRREAPKVVEEQESRVQYTVCIWRNGKLGLSGMAIADITLLSGFHALRADLEKLTS
LSDRYVSHFETDGPHVLLYFDSVPTTRECVGFGASQEVVVGLVQPSSAVLYDYYSPDHKC
SVFYAAPTKSQLLATLCSGDVCQCAEGKCPRLLRSLERRVEDKDGYRMRFACYYPRVEYG
FTVKVLREDGRAAFRLFESKITQVLHFRKDTMASIGQTRNFLSRASCRLRLEPNKEYLIM
GMDGETSDNKGDPQYLLDSNTWIEEMPSEQMCKSTRHRAACFQLKDFLMEFSSRGCQV
NT seq 5217 nt NT seq  +upstreamnt  +downstreamnt
atgcggctcctctgggggctggcctgggtgttcagcttctgtgcctcatccctgcagaag
cccaggttgctcctgttttccccttctgtggttaatttggggacccccctgtcggtgggg
gtacagctcctggatgcccctccaggacaggaggtaaaaggatcagtgttcctcagaaac
ccaaagggtggttcctgctccccaaagaaggactttaagctgagctcgggagatgacttt
gtgctgctcagccttgaggtcccactggaagatgtgaggagctgtggcctctttgacctg
cgcagagccccccacatccagctggtagctcagtctccgtggctaaggaacacagctttc
aaagccacagagactcagggtgtcaacttgctcttctcttcccgacgaggccacatcttt
gtgcagaccgatcagcctatctataatccggggcagcgggttcgttatcgggtctttgca
ctggatcaaaagatgcgcccatccactgatttcctcaccatcacagtggagaactcccat
ggcctccgtgtactcaagaaggagatatttacttccacatccatcttccaagatgccttc
accattccagacatctcagagcctgggacctggaagatctcagctaggttctcagatgga
ctggagtccaataggagcacccactttgaagtgaagaagtatgtccttcccaacttcgag
gtgaagattactccttggaagccatatatcctgatggtgcccagcaacagtgatgaaatc
caattagacatccaggccaggtacatctatgggaagcccgtgcagggcgtggcatacaca
cggtttgcgctcatggatgagcaagggaagaggactttccttcggggcctagagacgcag
gccaagttggtggaaggccggacccacatttccatctcaaaggaccagttccaggctgcc
ctggataaaatcaatattggggtcagagacctggaggggctgcgtctctatgctgctaca
gctgtcatcgagtctccaggaggagagatggaggaggcagaactcacgtcctggcgcttt
gtatcatctgccttctccttggatctcagccgcactaagaggcatcttgtgcctggggcc
cacttcctgctgcaggctctggtccaagaaatgtcaggctctgaagcctccaacgttcct
gttaaagtctctgccacattggtgtcaggctctgactcccaagtccttgacattcaacag
agcaccaatggaattggccaagtcagcatttccttccccatcccaccaactgtcacagaa
cttcgactcttggtgtctgcgggctccctctacccagccatagccaggctcaccgtgcaa
gccccaccttcaagaggcactggctttctttctattgagccactagaccctcggtcccct
agtgtgggggacacctttatcctaaaccttcaacctgtgggcatccctgcacctaccttc
tctcattactactacatgatcatctccagaggccagatcatggctatgggtcgggagccc
cggaagactgtgacctccgtctctgtgttggtggaccatcagctggctccctcgttctac
tttgtggcttacttctatcaccaaggacacccggtggccaactctctgctcatcaacatc
caatccagggactgtgagggcaagctgcaattgaaggtggatggtgccaaggagtatcgt
aatgcggacatgatgaagctccgaattcaaactgactccaaagccctggtggcactggga
gctgtggacatggctctgtatgctgtgggtggtcggtctcacaaacccctcgacatgagc
aaggtctttgaagtaatcaacagctacaatgttggctgtggtcctggaggtggggatgat
gcccttcaggtgttccaggatgctggtctggccttttctgatggtgatcgactaactcaa
accagagaggacctgagctgtcccaaggagaagaaaagtcggcaaaagagaaatgttaac
ttccagaaggctgtcagtgagaagttgggccagtattcttctccagatgccaagcgctgc
tgccaagacgggatgacgaagctgcccatgaagcgtacctgtgagcagcgggctgcccgt
gtgcctcagcaggcctgccgtgagcccttcttgtcctgttgcaagtttgctgaggacctt
cgcaggaaccagaccaggagccaggcacaccttgcccgaaacaaccacaacatgctgcag
gaggaagacttgatagatgaagacgacattcttgtgcgcacctccttcccagagaactgg
ctctggagagtggaacctgtagacagctccaaactgttgacagtgtggcttcctgattct
atgaccacatgggagattcatggtgtgagcctgtccaaaagcaaaggtctgtgtgtagcc
aagccaactcgtgttcgagtgttcagaaaattccacctgcacctgcgcctgcccatctcc
atccgccgctttgagcagtttgaattacggcctgttctttacaactatctgaatgatgat
gtggctgtgagtgtccatgtgaccccagttgaggggctgtgcctggctggtggtggaatg
atggcccagcaggtgacagtgccagcaggttctgcccggcctgtggccttctctgtggta
cccacagctgctgccaacgtgcccctgaaggtggtggctcgaggggtttttgatttaggg
gatgctgtgtctaagattctccaaattgagaaggaaggagccatccacagagaagagtta
gtctacaacctcgaccccctaaataacctgggtcggactttggagattcctggcagctcg
gatcccaacatcgtccctgacggagacttcagcagcttagtcagggttacagcctcggaa
cccttggagactatgggttctgaaggtgccttgtccccaggaggtgtggcctccctcctg
aggcttccccagggctgtgcagagcaaaccatgatctatttggctcctaccctgactgct
tccaactacctggacaggacagaacagtggagcaaactgtcccctgaaacaaaggaccat
gctgtggatctgatccaaaaaggatacatgaggatccagcagtttcggaagaatgatggc
tcctttggggcttggttacaccgggacagcagcacctggctgactgccttcgtgctgaag
attctgagtttggcccaggaacaggtgggcaactccccggagaagctgcaggagacggct
agctggctgctggcccagcagctgggtgatggctccttccacgacccatgtccagtcatc
cacagagcaatgcaggggggcttggtggggtctgacgagacagtggcactgaccgccttt
gtggtcattgcccttcaccatgggttggacgtcttccaggatgacgatgcgaagcagctg
aagaacagagtggaagcctccatcaccaaggcaaactcattcttggggcagaaggcaagt
gctgggctcctgggtgcccatgccgccgccatcacagcctatgcccttacgctgaccaag
gcctcggaggacctgcggaatgttgcccacaacagcctgatggccatggctgaggaaaca
ggggaacacctctactggggcttagtccttggctctcaggacaaagttgtgttgcgcccc
acagccccccgtagccctacagaacctgtgccccaggccccagccttgtggatcgaaacc
acagcctatgccctgctccacctgcttctgcgggagggaaagggaaaaatggctgacaag
gctgcatcctggctcacccaccagggaagcttccatggggcattccgcagtacccaggac
actgtggtcaccctggatgccctgtctgcctactggatcgcttcgcacaccactgaggag
aaagcactgaacgtgacgctcagctccatgggccgcaatgggcttaagacccacgggcta
cacttgaacaaccaccaagtcaagggcctggaggaggagctaaagttctccctgggcagc
acaatcagtgtcaaggtggaaggaaacagcaaaggcaccttgaagatccttcgtacctac
aatgtcctggacatgaagaacaccacatgccaggaccttcagatagaagtgaaggtcaca
ggcgctgtggaatacgcatgggatgccaatgaagactacgaagactactatgacatgcca
gccgcagatgaccccagcgtccccttgcagcctgtcacgcccctgcagctttttgagggt
cgtaggagccgccgcaggagggaggcccccaaggtggtcgaagagcaggagtccagagtt
cagtacactgtgtgtatctggcgaaatggcaagctggggctgtctggcatggccatcgca
gacatcaccctcctaagtggattccacgccctgagggctgacctggagaagctgacctct
ctctctgaccgttacgtgagtcactttgagactgacgggccccatgtcctgttgtacttt
gactcggtccctaccacccgggagtgtgtgggcttcggagcctcgcaggaggtggttgtg
ggactggtgcagccatccagtgctgtcctgtatgactactacagccctgatcacaagtgc
tctgtgttttatgctgcacccaccaagagccagctcctggccacactgtgctctggagat
gtatgccagtgcgctgaggggaagtgccctcgactgctaaggtcactggagcgaagggtg
gaggacaaggacggctaccggatgaggttcgcctgctattatccccgagtggagtatggc
ttcacggttaaggttcttcgagaagatggcagagctgccttccgtctctttgagtccaag
atcacccaagtcctgcatttcagaaaggacaccatggcctccataggtcagacccgcaac
ttcctgagccgggcctcttgccgccttcgtttggagcctaacaaagagtacttgatcatg
gggatggacggggaaaccagtgacaacaagggagacccccagtacttgctggactcaaat
acctggattgaggagatgccttcagaacaaatgtgcaagagcacccgccatcgggcagcc
tgtttccagctcaaagacttcctgatggagttcagcagccgggggtgccaggtgtga

DBGET integrated database retrieval system