KEGG   Mus musculus (mouse): 12273
Entry
12273             CDS       T01002                                 

Gene name
C5ar1, C5, C5aR, C5r, C5r1, Cd88, D7Msu, D7Msu1
Definition
(RefSeq) complement component 5a receptor 1
  KO
K04010  C5a anaphylatoxin chemotactic receptor 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04610  Complement and coagulation cascades
mmu04613  Neutrophil extracellular trap formation
mmu05150  Staphylococcus aureus infection
mmu05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    12273 (C5ar1)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    12273 (C5ar1)
   04613 Neutrophil extracellular trap formation
    12273 (C5ar1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    12273 (C5ar1)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    12273 (C5ar1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    12273 (C5ar1)
   04090 CD molecules [BR:mmu04090]
    12273 (C5ar1)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Peptide
   Anaphylatoxin
    12273 (C5ar1)
CD molecules [BR:mmu04090]
 Proteins
  12273 (C5ar1)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7TM_GPCR_Srw DUF621
Other DBs
NCBI-GeneID: 12273
NCBI-ProteinID: NP_001167021
MGI: 88232
Ensembl: ENSMUSG00000049130
Vega: OTTMUSG00000060709
UniProt: P30993
Position
7 A2; 7 8.77 cM
AA seq 351 aa
MDPIDNSSFEINYDHYGTMDPNIPADGIHLPKRQPGDVAALIIYSVVFLVGVPGNALVVW
VTAFEARRAVNAIWFLNLAVADLLSCLALPVLFTTVLNHNYWYFDATACIVLPSLILLNM
YASILLLATISADRFLLVFKPIWCQKVRGTGLAWMACGVAWVLALLLTIPSFVYREAYKD
FYSEHTVCGINYGGGSFPKEKAVAILRLMVGFVLPLLTLNICYTFLLLRTWSRKATRSTK
TLKVVMAVVICFFIFWLPYQVTGVMIAWLPPSSPTLKRVEKLNSLCVSLAYINCCVNPII
YVMAGQGFHGRLLRSLPSIIRNALSEDSVGRDSKTFTPSTTDTSTRKSQAV
NT seq 1056 nt   +upstreamnt  +downstreamnt
atggaccccatagataacagcagctttgaaatcaactatgatcactatggaaccatggat
cctaacatacctgcggatggcattcacctcccgaagcggcaacctggggatgttgcagcc
cttatcatctactcggtggtgttcctggtgggagtacctgggaatgccctggtggtgtgg
gtgacagccttcgaggccagacgggccgtcaacgccatctggtttctgaatctggcggtg
gccgacctcctctcgtgcttggcactgcctgtcctgttcacgaccgttttaaatcataac
tactggtactttgatgccaccgcctgtatagtcctgccctcgctcatcctgctcaacatg
tacgccagtatcctgctgctggctaccattagtgccgaccgtttcctgctggtgttcaag
cccatctggtgtcagaaggtccgcgggactggcctggcatggatggcctgtggagtggcc
tgggtcttagcattgctcctcaccattccatccttcgtgtaccgggaggcatataaggac
ttctactcagagcacactgtatgtggtattaactatggtgggggtagcttccccaaagag
aaggctgtggccatcctgcggctgatggtgggttttgtgttgcctctgctcactctaaac
atctgctacaccttcctcctgctccggacctggagtcgcaaggccacgcgctccaccaag
acgctcaaagtggtgatggctgtggtcatctgtttctttatcttctggctgccctatcag
gtgaccggggtgatgatagcgtggctgcccccgtcctcgcccaccttgaagagggtggag
aagctgaactccctgtgcgtgtccctggcctacatcaactgctgtgttaaccctatcatc
tacgtcatggctggccagggtttccatggacgactcctaaggtctctccccagcatcata
cgaaacgctctctctgaggattcagtgggcagggatagcaagactttcactccgtccacg
acggacacctcaacccggaagagtcaggcggtgtag

DBGET integrated database retrieval system