KEGG   Mus musculus (mouse): 12282
Entry
12282             CDS       T01002                                 

Gene name
Hyou1, AI415631, CBP-14, CBP-140, Cab14, Cab140, Grp1, Grp170, Orp, Orp150
Definition
(RefSeq) hypoxia up-regulated 1
  KO
K09486  hypoxia up-regulated 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    12282 (Hyou1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mmu03110]
    12282 (Hyou1)
Chaperones and folding catalysts [BR:mmu03110]
 Heat shock proteins
  HSP110
   12282 (Hyou1)
SSDB
Motif
Pfam: HSP70 MreB_Mbl AbiEi_3_N
Other DBs
NCBI-GeneID: 12282
NCBI-ProteinID: NP_067370
MGI: 108030
Ensembl: ENSMUSG00000032115
Vega: OTTMUSG00000034194
UniProt: Q9JKR6
Position
9; 9 A5.2
AA seq 999 aa
MAATVRRQRPRRLLCWALVAVLLADLLALSDTLAVMSVDLGSESMKVAIVKPGVPMEIVL
NKESRRKTPVTVTLKENERFLGDSAAGMAIKNPKATLRYFQHLLGKQADNPHVALYRSRF
PEHELIVDPQRQTVRFQISPQLQFSPEEVLGMVLNYSRSLAEDFAEQPIKDAVITVPAFF
NQAERRAVLQAARMAGLKVLQLINDNTATALSYGVFRRKDINSTAQNVMFYDMGSGSTVC
TIVTYQTVKTKEAGMQPQLQIRGVGFDRTLGGLEMELRLREHLAKLFNEQRKGQKAKDVR
ENPRAMAKLLREANRLKTVLSANADHMAQIEGLMDDVDFKAKVTRVEFEELCADLFDRVP
GPVQQALQSAEMSLDQIEQVILVGGATRVPKVQEVLLKAVGKEELGKNINADEAAAMGAV
YQAAALSKAFKVKPFVVRDAVIYPILVEFTREVEEEPGLRSLKHNKRVLFSRMGPYPQRK
VITFNRYSHDFNFHINYGDLGFLGPEDLRVFGSQNLTTVKLKGVGESFKKYPDYESKGIK
AHFNLDESGVLSLDRVESVFETLVEDSPEEESTLTKLGNTISSLFGGGTSSDAKENGTDA
VQEEEESPAEGSKDEPAEQGELKEEAEPPAEETSQPPPSEPKGDAAREGEKPDEKESGDK
PEAQKPNEKGQAGPEGAAPAPEEDKKPKPARKQKMVEEIGVELAVLDLPDLPEDELARSV
QKLEELTLRDLEKQEREKAANSLEAFIFETQDKLYQPEYQEVSTEEQREEISGKLSATST
WLEDEGFGATTVMLKDKLAELRKLCQGLFFRVEERRKWPERLSALDNLLNHSSIFLKGAR
LIPEMDQVFTEVEMTTLEKVINDTWAWKNATLAEQAKLPATEKPVLLSKDIEAKMMALDR
EVQYLLNKAKFTKPRPRPKDKNGTRAEPPLNASAGDQEEKVIPPAGQTEEAKPILEPDKE
ETGTEPADSEPLELGGPGAGPEQEEQSAGQKRPSKNDEL
NT seq 3000 nt   +upstreamnt  +downstreamnt
atggcagccacagtaagaaggcagaggccaaggaggctactctgttgggccttggtggct
gtcctcttggcagacctgttggcactgagcgacacattggctgtgatgtctgtagacctg
ggcagtgaatccatgaaggtggccattgtcaagcctggagtgcccatggagattgtattg
aacaaggaatctcggaggaaaactccagtgactgtgaccttgaaagaaaatgaaaggttt
ttaggtgatagtgcagccggcatggccatcaagaacccaaaggctacgctccgttatttc
cagcacctccttggaaaacaggcggataaccctcatgtggccctttaccggtcccgtttc
ccagaacatgagctaattgttgacccacagaggcagactgtgcgcttccagatcagtccg
cagctgcagttctctcccgaggaggtactgggcatggttctgaactactcccgttccttg
gctgaagattttgctgaacaacccattaaggatgcagtgatcaccgtgccagcctttttc
aaccaggctgagcgccgagctgtgctgcaggctgctcggatggctggcctcaaggtgctg
cagctcatcaatgacaacactgccacagccctcagctacggtgtcttccgccggaaagat
atcaattccactgcacagaacgtcatgttctatgacatgggctcgggcagcactgtgtgc
accatcgtcacctaccagacagtgaagactaaggaggctgggatgcaaccacagctgcag
atccggggcgtgggatttgaccgcaccctgggtggcctggagatggagcttcggcttcga
gaacacctggctaagctcttcaatgagcagcgcaagggccagaaagccaaggatgttcgg
gaaaacccccgggccatggccaaactgcttcgggaagccaaccggcttaaaaccgtcctg
agtgccaacgctgatcacatggcacagattgagggcttgatggatgatgtggacttcaag
gccaaagtaactcgggtggaattcgaggagctgtgtgcagatttgtttgaccgtgtgcct
ggacctgtgcagcaggccttgcagagtgcagagatgagcttggatcaaattgagcaggtg
atcctggtgggcggggccactcgtgttcccaaagttcaagaagtgctgctcaaggccgtg
ggcaaggaggaactaggaaagaacatcaatgcggacgaagctgctgccatgggggctgtg
taccaggcagcggcgctcagcaaggccttcaaagtgaagccatttgttgtgcgggatgct
gtcatttacccaatcctggtggagttcacaagggaggtggaggaggagcctgggctccga
agcctgaaacacaataagcgtgtgctcttctcccgaatggggccctaccctcagcgcaaa
gtcatcacctttaaccgctacagccatgatttcaacttccacatcaactacggtgacctg
ggcttcctggggcctgaggatcttcgggtatttggctcccagaatctgaccacagtaaaa
ctaaaaggcgtgggagagagcttcaagaaatatcccgactatgagtccaaaggcatcaag
gcccactttaacctggatgagagtggcgtgctcagtttagacagggtggagtccgtattt
gagaccctggtggaggatagcccagaggaagaatctactcttaccaaacttggcaacacc
atatccagcctgtttggaggtggtacctcatcagatgccaaagagaatggtactgatgct
gtacaggaggaagaggagagccccgctgaggggagcaaggatgagcctgcagagcagggg
gaactcaaggaagaagctgaacccccagcagaggagacctctcagcctccaccctctgag
cctaagggggatgcagcccgtgagggagagaaacctgatgaaaaagagagtggggacaag
cctgaggcccagaagcccaatgagaaggggcaagcagggcctgagggtgctgctccagct
cctgaggaggacaaaaagccgaaacctgcccggaagcagaaaatggtggaggagataggt
gtggagctggctgtcttggacctgcctgacttgccagaggatgagctggcccgttctgtg
cagaaacttgaagaactgaccctgcgcgacctagagaagcaggagagggagaaagctgcc
aacagcttggaggctttcatctttgagacccaggacaagctgtaccagcctgagtaccag
gaagtgtccactgaggaacagcgggaggagatctcggggaaactcagcgccacttctacc
tggctggaggatgagggatttggagccaccactgtgatgctgaaggacaagctggctgag
ctgagaaagctgtgccaagggctgttttttcgggtggaagaacgcaggaaatggccagag
cggctttcagctctggataatctcctcaaccattccagcattttcctcaagggtgcccgg
ctcatcccggagatggaccaggtcttcactgaagtggagatgacgacattagagaaagtc
atcaatgacacctgggcctggaagaatgcaactctggccgaacaagccaagcttcctgcc
acagagaagcctgtgctgctttcaaaagacattgaggccaaaatgatggccctggaccgg
gaggtacagtatctactcaataaggccaagtttaccaagccacggccacggcccaaagac
aagaatggcacccgggcagaacctcccctcaatgccagtgctggtgaccaagaggagaag
gtcattccacctgcaggccagactgaagaggcgaaacccattttagaacctgacaaagaa
gagactggtacggaaccagcagactcggagcctctggaattaggaggtcctggagctgga
cctgaacaggaagagcagtcagcaggacagaagcggccttcaaagaacgatgaactataa

KEGG   Mus musculus (mouse): 81500
Entry
81500             CDS       T01002                                 

Gene name
Sil1, 1810057E01Rik, AI042831, wz
Definition
(RefSeq) endoplasmic reticulum chaperone SIL1 homolog (S. cerevisiae)
  KO
K14001  nucleotide exchange factor SIL1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    81500 (Sil1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mmu03029]
    81500 (Sil1)
Mitochondrial biogenesis [BR:mmu03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Proteins involved in Fe-S cluster biogenesis
    81500 (Sil1)
SSDB
Motif
Pfam: Fes1 DUF4704 V-ATPase_H_C DUF4331 GlutR_dimer
Other DBs
NCBI-GeneID: 81500
NCBI-ProteinID: NP_109674
MGI: 1932040
Ensembl: ENSMUSG00000024357
UniProt: Q9EPK6
Position
18; 18 B1- B2
AA seq 465 aa
MAPQHLPSTRMASPGMLLGLLLTSCLTLCLSCQNSNNFALTNPEKSIHQESDTKETREEE
ELDTEILEVFHPTQEWQTLQPGQAVPAGSHVRMNLQTGVNEVKLQQEDKFQNNLKGFKRG
RRLDINANTYTSQDLKSALAKFKEGTEMENSKDELARQATVKQLFRPIEELKKEFDELNV
VLETDMQIMVRLINKFNSSSSSLEEKVAALFDLEYYVHQMDNAQDLLSFGGLQVVINGLN
STEPLVKEYAAFVLGAAFSSNPKVQVEAIEGGALQKLLVILATNQPLPAKKKVLFALCSL
LRHFPYAQQQFLKLGGLQVLRSLVQEKSAKVLAVRVVTLLYDLVTEKMFAEEEAELTQDS
SPEKLQQYRQVQLLPGLQEQGWCEITAQLLALPEHDAREKVLQTLGALLTTCRDRYRQDL
QLSRTLGRLQAEYQALASLELQEGEDDGYFRELLASINSLMKELR
NT seq 1398 nt   +upstreamnt  +downstreamnt
atggctcctcagcacctgccttcaactaggatggcctctccaggaatgctgctggggctg
ctgttgacttcctgtttaactctctgcctcagctgtcagaactcaaataattttgcactc
accaacccagagaagagcatccaccaggaatcagatacaaaggagaccagggaagaggag
gagctagacaccgagatcctggaggtgttccacccaactcaagagtggcagacccttcaa
ccaggtcaggctgttcctgcaggatcccatgtgcgaatgaacctacagactggagtaaac
gaggtgaagctccaacaagaagacaaatttcaaaataatctgaaaggatttaaaagaggc
agaaggctggacatcaacgccaacacatacacatctcaggacctcaagagtgcgctggcc
aaattcaaggaggggaccgagatggagaattcaaaggatgaactggcgagacaggccaca
gtcaagcagctcttccgccccattgaggagctgaagaaggaatttgatgagctgaacgtt
gttcttgagactgacatgcagattatggttcggctgataaacaagttcaacagctccagc
tccagcctagaagagaaggttgctgcgctctttgatcttgagtactatgtccatcagatg
gataacgcacaggacctgctgtcctttggtggccttcaagtggtgattaatgggctcaac
agcacagaacccctggtgaaggagtatgctgcttttgtgctgggggccgccttttccagc
aatccgaaggtccaggtggaagccatcgaagggggagccctgcagaagctgctggtcatc
ctggccacaaaccagcctctccccgccaagaagaaggtcctgtttgcactgtgctccctg
ctgcgccacttcccctatgcccagcagcagttcctgaagctcgggggcctgcaggtcctc
aggagcctggtacaggagaagagtgcgaaggtactggccgtgcgtgtggtcaccctgctc
tatgacctggtcactgagaagatgtttgctgaggaggaggcagagttgacccaggattca
tccccagagaagctgcagcagtatcgccaggtgcagctcctgccaggcctgcaggaacag
ggttggtgtgagatcaccgcccagctcctggcccttccagagcatgatgctcgggagaag
gtgctgcagacactgggtgccctcctgaccacctgccgggatcgctaccgtcaggacctc
cagttgagcaggacactagggcgtctccaagcagagtaccaagccctggcctccctggag
ctccaagaaggcgaagatgatggctacttccgggaactgctggcctccatcaacagcttg
atgaaggaactaagatga

DBGET integrated database retrieval system