KEGG   Mus musculus (mouse): 12286Help
Entry
12286             CDS       T01002                                 

Gene name
Cacna1a, APCA, BI, Caca1a, Cacnl1a4, Cav2.1, Ccha1a, EA2, FHM, HPCA, MHP, MHP1, SCA6, alpha1A, la, nmf352, rkr, smrl, tg
Definition
(RefSeq) calcium channel, voltage-dependent, P/Q type, alpha 1A subunit
  KO
K04344  voltage-dependent calcium channel P/Q type alpha-1A
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04020  Calcium signaling pathway
mmu04721  Synaptic vesicle cycle
mmu04723  Retrograde endocannabinoid signaling
mmu04724  Glutamatergic synapse
mmu04725  Cholinergic synapse
mmu04726  Serotonergic synapse
mmu04727  GABAergic synapse
mmu04728  Dopaminergic synapse
mmu04730  Long-term depression
mmu04742  Taste transduction
mmu04930  Type II diabetes mellitus
mmu05032  Morphine addiction
mmu05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    12286 (Cacna1a)
   04020 Calcium signaling pathway
    12286 (Cacna1a)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    12286 (Cacna1a)
   04727 GABAergic synapse
    12286 (Cacna1a)
   04725 Cholinergic synapse
    12286 (Cacna1a)
   04728 Dopaminergic synapse
    12286 (Cacna1a)
   04726 Serotonergic synapse
    12286 (Cacna1a)
   04730 Long-term depression
    12286 (Cacna1a)
   04723 Retrograde endocannabinoid signaling
    12286 (Cacna1a)
   04721 Synaptic vesicle cycle
    12286 (Cacna1a)
  09157 Sensory system
   04742 Taste transduction
    12286 (Cacna1a)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    12286 (Cacna1a)
   05033 Nicotine addiction
    12286 (Cacna1a)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    12286 (Cacna1a)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    12286 (Cacna1a)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   12286 (Cacna1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel
Motif
Other DBs
NCBI-GeneID: 12286
NCBI-ProteinID: NP_031604
MGI: 109482
Ensembl: ENSMUSG00000034656
Vega: OTTMUSG00000031448
UniProt: P97445 Q3UHA5 Q3UHN4
Position
8 C2; 8 40.95 cM
AA seq 2368 aa AA seqDB search
MARFGDEMPGRYGAGGGGSGPAAGVVVGAAGGRGAGGSRQGGQPGAQRMYKQSMAQRART
MALYNPIPVRQNCLTVNRSLFLFSEDNVVRKYAKKITEWPPFEYMILATIIANCIVLALE
QHLPDDDKTPMSERLDDTEPYFIGIFCFEAGIKIVALGFAFHKGSYLRNGWNVMDFVVVL
TGILATVGTEFDLRTLRAVRVLRPLKLVSGIPSLQVVLKSIMKAMIPLLQIGLLLFFAIL
IFAIIGLEFYMGKFHTTCFEEGTDDIQGESPAPCGTEEPARTCPNGTKCQPYWEGPNNGI
TQFDNILFAVLTVFQCITMEGWTDLLYNSNDASGNTWNWLYFIPLIIIGSFFMLNLVLGV
LSGEFAKERERVENRRAFLKLRRQQQIERELNGYMEWISKAEEVILAEDETDVEQRHPFD
GALRRATLKKSKTDLLNPEEAEDQLADIASVGSPFARASIKSAKLENSTFFHKKERRMRF
YIRRMVKTQAFYWTVLSLVALNTLCVAIVHYNQPEWLSDFLYYAEFIFLGLFMSEMFIKM
YGLGTRPYFHSSFNCFDCGVIIGSIFEVIWAVIKPGTSFGISVLRALRLLRIFKVTKYWA
SLRNLVVSLLNSMKSIISLLFLLFLFIVVFALLGMQLFGGQFNFDEGTPPTNFDTFPAAI
MTVFQILTGEDWNEVMYDGIKSQGGVQGGMVFSIYFIVLTLFGNYTLLNVFLAIAVDNLA
NAQELTKDEQEEEEAANQKLALQKAKEVAEVSPLSAANMSIAVKEQQKNQKPTKSVWEQR
TSEMRKQNLLASREALYGDAAERWPTPYARPLRPDVKTHLDRPLVVDPQENRNNNTNKSR
APEALRPTARPRESARDPDARRAWPGSPERAPGREGPYGRESEPQQREHAPPREHAPWDA
DTERAKAGDAPRRHTHRPVAEGEPRRHRARRRPGDEPDDRPERRPRPRDATRPARAADGE
GDDGERKRRHRHGPPAHDDRERRHRRRKENQGSGVPVSGPNLSTTRPIQQDLGRQDLPLA
EDLDNMKNNKLATGEPASPHDSLGHSGLPPSPAKIGNSTNPGPALATNPQNAASRRTPNN
PGNPSNPGPPKTPENSLIVTNPSSTQPNSAKTARKPEHMAVEIPPACPPLNHTVVQVNKN
ANPDPLPKKEEEKKEEEEADPGEDGPKPMPPYSSMFILSTTNPLRRLCHYILNLRYFEMC
ILMVIAMSSIALAAEDPVQPNAPRNNVLRYFDYVFTGVFTFEMVIKMIDLGLVLHQGAYF
RDLWNILDFIVVSGALVAFAFTGNSKGKDINTIKSLRVLRVLRPLKTIKRLPKLKAVFDC
VVNSLKNVFNILIVYMLFMFIFAVVAVQLFKGKFFHCTDESKEFERDCRGKYLLYEKNEV
KARDREWKKYEFHYDNVLWALLTLFTVSTGEGWPQVLKHSVDATFENQGPSPGYRMEMSI
FYVVYFVVFPFFFVNIFVALIIITFQEQGDKMMEEYSLEKNERACIDFAISAKPLTRHMP
QNKQSFQYRMWQFVVSPPFEYTIMAMIALNTIVLMMKFYGASVAYENALRVFNIVFTSLF
SLECVLKVMAFGILNYFRDAWNIFDFVTVLGSITDILVTEFGNNFINLSFLRLFRAARLI
KLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVFGNIGIDGEDEDSDED
EFQITEHNNFRTFFQALMLLFRSATGEAWHNIMLSCLSGKPCDKNSGILTADCGNEFAYF
YFVSFIFLCSFLMLNLFVAVIMDNFEYLTRDSSILGPHHLDEYVRVWAEYDPAACGRIHY
KDMYSLLRVISPPLGLGKKCPHRVACKRLLRMDLPVADDNTVHFNSTLMALIRTALDIKI
AKGGADKQQMDAELRKEMMAIWPNLSQKTLDLLVTPHKSTDLTVGKIYAAMMIMEYYRQS
KAKKLQAMREEQNRTPLMFQRMEPPSPTQEGGPSQNALPSTQLDPGGGLMAHEGGMKESP
SWVTQRAQEMFQKTGTWSPERGPPIDMPNSQPNSQSVEMREMGTDGYSDSEHYLPMEGQT
RAASMPRLPAENQRRRGRPRGNDLSTISDTSPMKRSASVLGPKARRLDDYSLERVPPEEN
QRYHQRRRDRGHRTSERSLGRYTDVDTGLGTDLSMTTQSGDLPSKDRDQDRGRPKDRKHR
PHHHHHHHHHHPPAPDRDRYAQERPDTGRARAREQRWSRSPSEGREHTTHRQGSSSVSGS
PAPSTSGTSTPRRGRRQLPQTPCTPRPLVSYSPAPRRPAARRMAGPAAPPGGSPRGCRRA
PRWPAHAPEGPRPRGADYTEPDSPREPPGGAHDPAPRSPRTPRAAGCASPRHGRRLPNGY
YAGHGAPRPRTARRGAHDAYSESEDDWC
NT seq 7107 nt NT seq  +upstreamnt  +downstreamnt
atggcccgctttggagacgagatgccgggccgctacggcgcaggcggaggaggctcaggg
ccggccgccggggtggtcgtgggcgccgcgggcggccgaggagccgggggcagccggcag
ggcgggcagcccggagcgcagaggatgtacaagcagtcgatggcgcagagagcgcggacc
atggccctctacaaccccatccctgtccgccagaactgcctcacggtcaaccgctccctg
ttcctcttcagtgaagacaacgtggtgagaaaatacgccaaaaagatcactgaatggcct
cccttcgagtacatgatcctggccaccatcattgctaactgcatcgtcctggccctggag
cagcacctccctgatgatgacaagacacccatgtctgagcggctggatgacacggaacca
tacttcattggaatcttctgttttgaggctggaattaagatcgtggctcttggctttgcc
ttccacaaaggctcctacctgaggaatggctggaacgtcatggactttgtcgtggtgcta
acaggcatcttggccactgtcgggacggagtttgacctacggacactgagggcggttcgt
gtgctgcggccactcaagctggtgtctggaatcccaagtttacaagtcgtcctgaagtca
atcatgaaggcgatgatccctctgctgcagatcggcctcctcctgttttttgcaatcctt
atttttgcaatcatagggttagaattttatatggggaaatttcataccacctgctttgaa
gaggggacagacgacatccagggtgagtcgccagctccgtgtgggacagaggagcctgcc
cgcacctgccccaacgggaccaaatgtcagccgtactgggaagggcccaacaacggcatc
actcagttcgacaacatcctgtttgctgtgctcactgttttccagtgcatcaccatggaa
ggctggactgatctcctctacaatagcaacgatgcctcagggaacacttggaactggttg
tacttcatccccctcatcatcatcggctccttttttatgctgaaccttgttctgggtgtg
ctgtctggggagtttgccaaagaaagggaacgtgtggagaaccggagagcttttctgaag
ctcagaagacaacagcagattgaacgtgagctcaatggatacatggagtggatctcaaaa
gcagaagaggtgattcttgcggaggacgagacagacgtggagcagaggcacccttttgat
ggagctcttcggagagctactctgaagaaaagcaagacagacctgctcaaccctgaggag
gccgaggaccagctggctgacatcgcgtctgtggggtctcccttcgccagagccagcatc
aaaagtgccaagctggagaactcgactttttttcacaagaaggagagaagaatgcgtttc
tacatccgccgcatggtcaaaactcaggccttctactggaccgtgctcagtctggtagcc
ctcaacacgctgtgcgtcgccattgtccactacaaccagcccgagtggctctccgacttc
ctctactatgcagaattcattttcttaggactctttatgtccgaaatgtttataaaaatg
tacgggctcgggacgcggccttacttccactcttccttcaactgctttgactgtggggtc
atcattgggagcatctttgaagtcatctgggctgtcatcaaacctggtacatcctttgga
atcagtgtgttacgagctctcaggttattgcgaattttcaaagtcacaaagtactgggca
tctctcagaaacctggttgtctccctcctcaactccatgaagtccatcataagtctgttg
ttcctccttttcctgttcatcgttgtctttgccctcctggggatgcagctgttcggtggc
caatttaattttgatgaggggactccgcccaccaacttcgacacttttccagcagcaata
atgactgtgtttcagatcctgactggcgaggattggaatgaggtcatgtatgatgggatc
aagtctcaggggggcgtgcagggcggcatggtgttctccatctacttcatcgtcctcacc
ctcttcgggaactacaccctgctgaacgtgttcttggccatcgcagtggacaacctggcc
aatgcccaggagctcaccaaggatgagcaagaagaggaagaggcagccaatcagaagctg
gctctacagaaagccaaggaggtagcagaagtgagtcccctgtctgcagccaacatgtcc
atagccgtgaaggagcagcagaagaaccagaagcctaccaagtcggtgtgggagcagcgc
accagcgagatgcgcaagcagaacctgctggccagccgcgaggcgctgtacggggacgcg
gctgagcgctggcccaccccctacgcgcgcccgctgcggcccgacgtgaagactcacttg
gaccggccgcttgtggtggacccgcaggagaaccgtaacaacaacaccaacaagagccgt
gcgccagaagcgctgcgcccgaccgcgcggccccgcgaaagcgcgcgcgaccccgacgcg
cggcgcgcctggcccggcagccctgagcgcgcccctggacgagagggcccgtatgggcgc
gagagcgagcctcagcagcgcgagcacgcgccgccccgcgagcacgcaccctgggacgcg
gacaccgagcgcgccaaagccggggacgcgccccgccgccacacgcaccgacctgtggcg
gagggcgagcctcgccgccaccgcgcccgccgccggcccggggacgaacccgacgacagg
ccagagcgcaggccacgtccccgcgacgccactaggccggcccgcgctgcagacggcgaa
ggcgacgatggggagcgcaagcggcgacaccgacacgggccgccggcccacgacgacagg
gagcgcagacaccgacgcagaaaagagaaccagggctctggggtccccgtgtctggtccc
aacttgtccaccaccaggccaatccagcaggacctgggccgccaggacctgccgctggct
gaggatcttgacaacatgaagaataacaagctggccaccggggaacctgccagtccccac
gacagcctgggccacagcggccttccccccagccccgccaaaatcgggaacagcaccaac
cctggtcccgccttggccaccaatccccagaacgctgccagccgcaggacgcccaacaat
ccgggcaacccgtccaaccccggcccccccaagactcccgagaacagccttatcgtcacc
aaccccagcagcacccagcccaactcagcgaagactgccaggaaacccgagcacatggcg
gtggagatccccccagcctgcccgcccctcaaccacaccgtggtccaagtaaacaaaaac
gccaacccagacccactgccaaagaaagaggaagagaagaaagaggaagaggaggcagac
cccggggaggacggcccaaagcccatgccgccctacagctccatgttcatcctctccacc
accaacccccttcgccggctgtgccattacatcctgaacctgcgctacttcgagatgtgc
atcctcatggtcattgccatgagcagcatcgctctggccgccgaggacccggtgcagccc
aacgcaccccgcaacaatgtgctgcgatattttgactatgtttttacaggcgtgtttacc
tttgagatggtgatcaagatgatcgacctgggcctcgtcttgcatcagggggcctatttc
cgtgacctatggaacattctggacttcatagtggtcagtggggccctggtggcctttgcc
ttcactggcaatagcaaaggaaaggacattaacaccattaagtctctccgagtcctccgg
gtgctacgacctctaaagaccatcaagcggctgccaaagctgaaggccgtgtttgactgc
gtggtgaactcgctcaagaacgtcttcaacatcctcattgtgtacatgctgttcatgttc
atcttcgctgtggtagccgtgcagctcttcaagggcaagttcttccactgcacggacgag
tccaaggagttcgagagagactgtcgaggcaagtacctcctgtacgagaagaacgaagtg
aaggcccgggaccgcgagtggaagaagtacgagttccactacgacaacgtgctctgggct
ctgctcacacttttcacagtgtccacaggagagggctggccacaggtcctcaagcactca
gtggatgctacttttgagaaccagggccccagccccgggtaccgcatggagatgtccatc
ttctacgtggtgtactttgtagtgtttcccttcttctttgtcaatatcttcgtggccttg
atcatcatcacctttcaggagcagggagacaagatgatggaagagtacagcctggagaaa
aatgagagggcctgcatcgactttgccatcagtgccaagccgctgaccaggcacatgccc
cagaacaagcagagcttccagtatcgaatgtggcagttcgtcgtgtccccaccctttgag
tacaccatcatggccatgatcgctctcaacaccatcgtgctaatgatgaagttctacgga
gcctcggtggcctatgaaaacgcccttcgcgtgttcaacattgtcttcacctccctcttc
tctctcgaatgtgtgctcaaagtcatggcttttgggattctgaattatttccgcgatgcc
tggaacatcttcgactttgtgactgttctgggcagcatcacagacatcctcgtcaccgag
tttgggaataacttcatcaacctgagctttctccgcctcttccgtgctgccagactcatc
aaactcctccgccagggttacaccatccgcattctcctctggactttcgtgcagtccttc
aaggccctaccttatgtctgtctgctgatcgccatgctcttcttcatctacgccatcatc
gggatgcaggtgtttggcaacatcggcattgacggggaagacgaggacagcgacgaggat
gaattccaaatcacggagcacaataacttccggaccttcttccaagcgctcatgcttctc
ttccggagcgccacaggagaagcgtggcacaacatcatgctctcctgcctcagcgggaag
ccgtgcgataagaactctgggatcctcacggcagactgcggcaacgagttcgcgtacttc
tactttgtctcgttcatcttcctgtgctcgtttctgatgctgaatctctttgtcgctgtc
atcatggacaacttcgagtacctcacccgagattcttccatcctgggcccccatcacttg
gatgaatacgtgcgtgtctgggcagagtatgaccctgctgcctgcggccgcattcactat
aaggacatgtacagtttattgcgagtaatatcgccccctctcggcttaggcaagaaatgt
cctcatagggttgcttgcaagagactcctgcggatggacctgccggtagcagatgacaac
acagttcacttcaactccaccctgatggctctgatccgaaccgcccttgatatcaaaatt
gccaagggtggagctgacaagcagcagatggatgcagagcttcgcaaggagatgatggcc
atttggcccaacctgtctcagaagaccctggatctgctggtcacacctcacaagtccacg
gacctgacagtgggtaagatctacgcagccatgatgatcatggagtattaccggcagagc
aaggccaagaaactgcaggccatgcgagaggagcagaaccggacaccactcatgttccag
cgcatggagcctccatcaccaacacaggagggaggacccagccagaatgcccttccctcc
actcagctggacccaggaggaggcctgatggctcacgaaggcggcatgaaggagagcccg
tcctgggtgacccagcgggcccaagagatgttccagaagactggcacctggagcccagag
cgagggccacccatcgacatgcctaacagccagcccaactcccagtctgtggagatgcga
gaaatgggtactgatggctactcagacagcgaacactacctccccatggaaggccagacc
agggccgcctccatgccccgcctcccagcagagaaccagaggagaaggggccggccacgt
ggaaatgacctcagtaccatctctgataccagccccatgaagcgctcagcctctgtgctg
ggacccaaagcccggcgactggatgactactcactagagcgggtaccgcctgaggagaac
caacggtaccaccaacgtcgccgggaccgtggccaccgcacctctgagcgctctctgggc
cgatacactgatgtggacacaggtttggggacagatctgagcatgaccacccaatcgggt
gacctgccctccaaagatcgggaccaggaccggggccgacccaaggaccggaagcatcgg
ccacaccaccaccaccaccaccatcatcatcatcccccggcccccgaccgggatcgctac
gcacaggagcggccggacaccggccgggcgcgggcccgggagcagcgctggtcccgctcg
cccagcgaaggtcgggagcacacgacacacagacagggcagtagttccgtcagtggaagc
ccagccccctctacgtccggcaccagcacgccgcggcgcggccgccgccagctcccccag
accccctgcaccccgcggccgcttgtgtcctactcgcccgctccgcgcaggcctgcggcg
cgcaggatggcgggtcccgcagcgccccctggcggctcgccgcggggttgccgccgtgcg
ccgcgctggcctgcgcatgcgcctgagggcccgcggccgcgcggtgccgactacaccgag
cccgacagcccgcgcgagccgccagggggcgcgcacgatcccgcgccgcggtcgcccagg
actccgcgcgccgcgggctgcgcgtcaccgcgccacggccgcaggctgcccaatggttac
tacgcggggcacggcgcgccgcggccgcgcacagcccgcaggggcgcgcacgacgcgtac
agcgagagcgaggacgactggtgctaa

DBGET integrated database retrieval system