KEGG   Mus musculus (mouse): 12288
Entry
12288             CDS       T01002                                 

Gene name
Cacna1c, Cav1, Cav1.2, Cchl1, Cchl1a1, D930026N18Rik, MBC, MELC-CC
Definition
(RefSeq) calcium channel, voltage-dependent, L type, alpha 1C subunit
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04020  Calcium signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04024  cAMP signaling pathway
mmu04260  Cardiac muscle contraction
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04270  Vascular smooth muscle contraction
mmu04713  Circadian entrainment
mmu04720  Long-term potentiation
mmu04723  Retrograde endocannabinoid signaling
mmu04724  Glutamatergic synapse
mmu04725  Cholinergic synapse
mmu04726  Serotonergic synapse
mmu04727  GABAergic synapse
mmu04728  Dopaminergic synapse
mmu04742  Taste transduction
mmu04911  Insulin secretion
mmu04912  GnRH signaling pathway
mmu04921  Oxytocin signaling pathway
mmu04924  Renin secretion
mmu04925  Aldosterone synthesis and secretion
mmu04927  Cortisol synthesis and secretion
mmu04929  GnRH secretion
mmu04930  Type II diabetes mellitus
mmu04934  Cushing syndrome
mmu04935  Growth hormone synthesis, secretion and action
mmu05010  Alzheimer disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05031  Amphetamine addiction
mmu05410  Hypertrophic cardiomyopathy
mmu05412  Arrhythmogenic right ventricular cardiomyopathy
mmu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    12288 (Cacna1c)
   04020 Calcium signaling pathway
    12288 (Cacna1c)
   04024 cAMP signaling pathway
    12288 (Cacna1c)
   04022 cGMP-PKG signaling pathway
    12288 (Cacna1c)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    12288 (Cacna1c)
   04929 GnRH secretion
    12288 (Cacna1c)
   04912 GnRH signaling pathway
    12288 (Cacna1c)
   04921 Oxytocin signaling pathway
    12288 (Cacna1c)
   04935 Growth hormone synthesis, secretion and action
    12288 (Cacna1c)
   04924 Renin secretion
    12288 (Cacna1c)
   04925 Aldosterone synthesis and secretion
    12288 (Cacna1c)
   04927 Cortisol synthesis and secretion
    12288 (Cacna1c)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    12288 (Cacna1c)
   04261 Adrenergic signaling in cardiomyocytes
    12288 (Cacna1c)
   04270 Vascular smooth muscle contraction
    12288 (Cacna1c)
  09156 Nervous system
   04724 Glutamatergic synapse
    12288 (Cacna1c)
   04727 GABAergic synapse
    12288 (Cacna1c)
   04725 Cholinergic synapse
    12288 (Cacna1c)
   04728 Dopaminergic synapse
    12288 (Cacna1c)
   04726 Serotonergic synapse
    12288 (Cacna1c)
   04720 Long-term potentiation
    12288 (Cacna1c)
   04723 Retrograde endocannabinoid signaling
    12288 (Cacna1c)
  09157 Sensory system
   04742 Taste transduction
    12288 (Cacna1c)
  09159 Environmental adaptation
   04713 Circadian entrainment
    12288 (Cacna1c)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    12288 (Cacna1c)
   05020 Prion disease
    12288 (Cacna1c)
   05022 Pathways of neurodegeneration - multiple diseases
    12288 (Cacna1c)
  09165 Substance dependence
   05031 Amphetamine addiction
    12288 (Cacna1c)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    12288 (Cacna1c)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    12288 (Cacna1c)
   05414 Dilated cardiomyopathy
    12288 (Cacna1c)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    12288 (Cacna1c)
   04934 Cushing syndrome
    12288 (Cacna1c)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    12288 (Cacna1c)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   12288 (Cacna1c)
SSDB
Motif
Pfam: Ion_trans CAC1F_C GPHH Ca_chan_IQ PKD_channel Etmic-2 DUF4834
Other DBs
NCBI-GeneID: 12288
NCBI-ProteinID: NP_001153005
MGI: 103013
Ensembl: ENSMUSG00000051331
Vega: OTTMUSG00000049004
UniProt: Q01815 Q0PCR6
Position
6 F1; 6 55.86 cM
AA seq 2139 aa
MVNENTRMYVPEENHQGSNYGSPRPAHANMNANAAAGLAPEHIPTPGAALSWQAAIDAAR
QAKLMGSAGNATISTVSSTQRKRQQYGKPKKQGGTTATRPPRALLCLTLKNPIRRACISI
VEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIA
YGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFR
VLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCYN
QEGIIDVPAEEDPSPCALETGHGRQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCI
TMEGWTDVLYWMQDAMGYELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGD
FQKLREKQQLEEDLKGYLDWITQAEDIDPENEDEGMDEDKPRNMSMPTSETESVNTENVA
GGDIEGENCGARLAHRISKSKFSRYWRRWNRFCRRKCRAAVKSNVFYWLVIFLVFLNTLT
IASEHYNQPHWLTEVQDTANKALLALFTAEMLLKMYSLGLQAYFVSLFNRFDCFIVCGGI
LETILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFL
FIIIFSLLGMQLFGGKFNFDEMQTRRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYG
GPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKERKKLAR
TASPEKKQEVMEKPAVEESKEEKIELKSITADGESPPTTKINMDDLQPSENEDKSPHSNP
DTAGEEDEEEPEMPVGPRPRPLSELHLKEKAVPMPEASAFFIFSPNNRFRLQCHRIVNDT
IFTNLILFFILLSSISLAAEDPVQHTSFRNHILGNADYVFTSIFTLEIILKMTAYGAFLH
KGSFCRNYFNILDLLVVSVSLISFGIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQ
CVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKLYTCSDSSKQTEAECKGNYITYKDGE
VDHPIIQPRSWENSKFDFDNVLAAMMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYRV
EISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLR
RYIPKNQHQYKVWYVVNSTYFEYLMFVLILLNTICLAMQHYGQSCLFKIAMNILNMLFTG
LFTVEMILKLIAFKPKGYFSDPWNVFDFLIVIGSIIDVILSETNPAEHTQCSPSMSAEEN
SRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQ
VFGKIALNDTTEINRNNNFQTFPQAVLLLFRCATGEAWQDIMLACMPGKKCAPESEPSNS
TEGETPCGSSFAVFYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRI
WAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNA
TLFALVRTALRIKTEGNLEQANEELRAIIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYA
TFLIQEYFRKFKKRKEQGLVGKPSQRNALSLQAGLRTLHDIGPEIRRAISGDLTAEEELD
KAMKEAVSAASEDDIFRRAGGLFGNHVTYYQSDSRGNFPQTFATQRPLHINKTGNNQADT
ESPSHEKLVDSTFTPSSYSSTGSNANINNANNTALGRFPHPAGYSSTVSTVEGHGPPLSP
AVRVQEAAWKLSSKRCHSRESQGATVNQEIFPDETRSVRMSEEAEYCSEPSLLSTDMFSY
QEDEHRQLTCPEEDKREIQPSPKRSFLRSASLGRRASFHLECLKRQKDQGGDISQKTALP
LHLVHHQALAVAGLSPLLQRSHSPTTFPRPCPTPPVTPGSRGRPLRPIPTLRLEGAESSE
KLNSSFPSIHCSSWSEETTACSGSSSMARRARPVSLTVPSQAGAPGRQFHGSASSLVEAV
LISEGLGQFAQDPKFIEVTTQELADACDMTIEEMENAADNILSGGAQQSPNGTLLPFVNC
RDPGQDRAVAPEDESCAYALGRGRSEEALADSRSYVSNL
NT seq 6420 nt   +upstreamnt  +downstreamnt
atggtcaatgaaaacacgaggatgtacgttccagaggaaaaccaccaaggttccaactat
gggagcccacgcccagctcatgccaacatgaatgccaatgcagctgcaggacttgctccc
gagcacatccctactccaggggcagcactgtcctggcaggcagccatcgatgccgcccgg
caggccaagctcatgggcagtgctggcaacgcaaccatctctaccgtcagttccacacag
cggaagcggcagcagtatgggaaacccaagaagcaggggggcacaaccgccacacggccg
ccccgggctctgctgtgtctgaccctgaagaaccctatccggagggcgtgcataagcatt
gttgaatggaaaccatttgaaatcattattttactgactatttttgccaattgtgtggcc
ttagcaatctatattccctttccggaagacgactccaacgccaccaactccaacctggaa
cgagtggagtatctcttcctcatcatttttaccgtggaagcatttttaaaagtaattgcc
tacggacttctcttccaccccaacgcttacctccgcaatggttggaatttactggatttt
ataatcgtggttgtagggctttttagtgcaattttagaacaagcaaccaaagctgatggg
gccaatgctctaggagggaaaggagctggattcgacgtgaaggcactgagagcgttccgc
gtgctccgtccactgcggctagtgtccggagtcccaagtctccaggtggtcctgaactcc
atcatcaaggccatggtgcctctgctgcacattgcccttcttgtgctcttcgtcatcatc
atttatgctattatcggcctggagctcttcatgggaaagatgcacaagacctgctacaac
caggagggcataatagatgttccggcagaagaggatccttccccttgtgctttggagaca
ggccatgggcgacagtgtcagaacgggaccgtgtgcaaacccgggtgggatgggcccaag
cacggcatcaccaacttcgacaacttcgccttcgccatgctgacggtgttccagtgtatc
accatggagggctggacagacgtgctgtactggatgcaagacgctatgggctatgagttg
ccctgggtgtattttgtcagtctggtcatctttggatcctttttcgttctaaatctggtt
ctcggtgttttgagcggggagttttccaaagagagggagaaagccaaagcccgaggagat
ttccagaagcttcgagagaagcagcaactagaagaagatctcaaaggctacctggactgg
atcacccaggcagaagacattgaccccgagaatgaggacgagggcatggatgaagacaag
cctcgaaacatgagcatgcccacaagtgagactgagtctgtcaacactgaaaacgtggct
ggaggtgacatcgagggagaaaactgtggagccaggcttgcccatcggatctccaaatcc
aaattcagccgctactggcgcaggtggaatcgattctgcagaagaaaatgccgtgcagca
gttaagtccaacgtcttctactggctcgtgatcttcctggtgttcctcaacaccctcacc
attgcctccgaacattacaaccagcctcactggctcacagaagtgcaagacacagccaat
aaagccctcctggcccttttcactgcagaaatgctcctgaagatgtacagcctgggtctt
caggcctattttgtgtccctcttcaaccgctttgactgtttcattgtgtgtgggggcatc
ctggagaccatcctggtggagacgaagatcatgtctcccctgggcatctctgtgctgaga
tgtgtgcggttgctcaggatcttcaagatcaccaggtactggaattccttgagcaacctt
gtggcatccttgctgaactcagtgcgctccattgcctccctgctgctgctcctcttcctc
ttcatcatcatcttctccctcctggggatgcagctctttggagggaagttcaatttcgat
gagatgcagacccgtaggagcacgttcgataacttcccgcagtctctcctcactgtgttt
cagatcctgaccggggaggactggaattcggtgatgtatgatgggatcatggcttatggc
ggcccctcttttccagggatgttagtctgtatttacttcatcatcctcttcatctgtgga
aattatatcctactgaatgtgttcttggccattgcggtggacaacctggctgatgcggag
agcctgacctcagcccaaaaggaggaggaagaagagaaggagaggaagaagctggccagg
actgccagcccagaaaagaaacaggaggtgatggagaagccagccgtggaggagagcaaa
gaggagaaaattgaactgaaatccattacagccgatggagaatccccacccactaccaag
atcaacatggatgacctccagcccagtgaaaacgaggataagagtccccactccaaccca
gacactgcaggggaagaggatgaagaggagccagagatgcctgtggggccacgcccccgg
cccctgtctgagctgcaccttaaggaaaaggcagttcccatgccggaagccagtgcattt
ttcatcttcagcccaaacaacaggttccgcctgcagtgccaccgtattgtcaatgacacg
atcttcaccaacctcatcctcttcttcattctgctcagcagcatctctctggctgctgag
gaccccgtccagcacacctccttcaggaaccatatcctaggcaatgcagactatgtcttc
actagtatctttacattagaaattatccttaagatgactgcttacggggctttcctgcac
aagggctctttctgccgaaactacttcaatatcctggacctgctggtggttagcgtgtcc
ctcatctcctttggcatccagtccagcgcgatcaacgttgtgaagattttacgagtgctg
cgagtcctcagacccctgagggccatcaacagggccaaggggctaaagcatgtggttcag
tgcgtgtttgtggccatccggaccatcgggaacatcgtaattgtcaccactctgctgcag
ttcatgttcgcctgcattggggtccagctcttcaagggaaagctctatacctgttcggat
agttctaaacagacggaggcagaatgcaagggtaactatatcacatacaaagatggagag
gtcgatcaccccattatccagcctcgaagctgggagaacagcaagtttgactttgacaat
gttttggcagccatgatggctctcttcaccgtctccaccttcgaagggtggccagagctg
ctgtaccgctccattgactcccacacagaagacaagggccccatctacaactaccgtgtg
gagatctccatcttcttcatcatctatatcatcatcattgccttcttcatgatgaacatc
ttcgtgggtttcgtcattgtcaccttccaggagcagggggaacaagagtacaagaactgt
gagctggacaagaaccagagacaatgtgtggaatatgccctcaaggcccgacccttgcga
aggtacatccccaagaaccagcaccagtacaaagtgtggtacgtggtcaactctacctac
ttcgagtatctgatgttcgttctcatcctgctcaacaccatctgcctggccatgcagcac
tatggccagagctgcctcttcaaaatcgccatgaatatactcaacatgcttttcaccggc
ctcttcacagtggagatgatcctgaagctcattgccttcaaacccaagggttactttagt
gatccctggaatgtttttgacttcctcatcgtcattgggagcataattgatgtcattctc
agtgagactaatccagctgaacatacccaatgctctccctctatgagtgcagaggagaac
tcccgcatctccatcaccttcttccgcctcttccgggtcatgcgcctggtgaagctgctg
agccgcggggaaggcatccgaaccctgctgtggaccttcatcaagtccttccaggctctg
ccctatgtggctcttttgattgtgatgctgttctttatctatgcagtgattgggatgcag
gtgtttgggaagattgccctgaatgacaccacagagatcaatcggaacaacaacttccag
acgttcccccaggctgtgttactgctgttcaggtgtgccaccggagaggcctggcaggac
atcatgctggcctgcatgccaggcaagaagtgtgccccagagtctgagcccagcaacagc
acggaaggggagaccccctgtggcagcagctttgctgtcttctacttcatcagcttctac
atgctctgtgccttcctgatcatcaacctctttgtagctgttatcatggacaactttgac
tacctgactagggattggtctatcctcggtccccatcacctggatgaattcaagagaatc
tgggccgagtatgaccctgaagccaagggtcggatcaaacacttggatgtggtgaccctc
ctccgtcgaattcagcccccactgggttttgggaaattgtgtcctcaccgtgtggcctgc
aaacgcctggtgtccatgaacatgcctctgaacagcgatggcacagtcatgttcaatgct
accctgtttgccctcgtcaggacagccctgaggatcaaaacagaagggaacctagagcaa
gccaatgaggagcttcgggccatcatcaagaaaatctggaagaggactagcatgaagctg
ttggaccaggtggtgccccctgcaggcgatgacgaggtcacagtgggcaagttctatgcc
accttcctgatccaagagtacttcaggaaattcaagaagcgaaaagagcaggggctggtg
ggcaagccctcacaaaggaatgcactgtccctccaggctggcttgcgcaccttgcatgac
attgggcctgagatccggcgggccatctctggggatctgactgctgaggaggagttggac
aaggctatgaaggaggcggtgtctgctgcctccgaagatgacatcttcaggagggctgga
ggcctgttcggcaaccatgtcacctactatcagagtgacagcaggggcaactttcctcag
acgttcgccacccagcgcccactgcacatcaacaagacagggaacaaccaagctgacact
gagtcaccgtcccatgagaagctggtggactccacgttcacccccagcagctactcatcc
acgggctccaatgccaacatcaacaatgccaacaacactgccctgggccgcttcccccat
cccgctggctactccagcacggtcagcactgtggagggccatgggcctcccttgtcccct
gctgtccgagtacaggaggcagcatggaagctcagctctaagaggtgccactcccgagag
agccagggagccacggtgaatcaggagatatttccagatgagacccgcagcgtaaggatg
agtgaagaagccgagtactgcagtgagcccagcctgctctccacagatatgttctcctac
caggaagatgaacaccgacaactgacctgcccagaggaggacaagagggagatccagcca
tctccaaagaggagtttccttcgctctgcctctctaggtcgaagggcctccttccatctg
gaatgtctaaagcgacaaaaggatcaagggggagacatctctcagaagacagccttgccc
ttgcatctggttcatcatcaggcattggcagtggcaggcttgagccccctcctgcagaga
agccattctcctaccacattccccaggccgtgccccacaccccctgtcactccaggcagc
cggggcagacccctacggcccatccctaccctacggctggagggggcagagtccagcgag
aaactcaacagcagcttcccatccatccactgcagctcctggtctgaggagacgacagcc
tgtagtgggagcagcagcatggcccggagagcccggcccgtctccctcaccgtgcccagc
caggctggagctccagggagacagttccatggcagtgccagcagcctggtggaagcggtc
ttgatttcagaaggactgggacagtttgctcaagatcccaagttcatcgaggtcaccacc
caggagctggctgacgcctgcgacatgacaatagaggagatggagaacgccgcagacaac
atcctcagtgggggcgcccagcagagccccaacggcaccctcttaccttttgtgaactgc
agggacccggggcaggacagggctgtggccccagaggacgagagctgcgcatatgccctg
gggcgaggccggagcgaggaggcgctcgcggacagcaggtcctacgtcagcaacctgtag

KEGG   Mus musculus (mouse): 12289
Entry
12289             CDS       T01002                                 

Gene name
Cacna1d, 8430418G19Rik, C79217, Cach3, Cacn, Cacn4, Cacnl1a2, Cav1.3, Cchl, Cchl1, Cchl1a, Cchl1a2, D-LTC, D-LTCC
Definition
(RefSeq) calcium channel, voltage-dependent, L type, alpha 1D subunit
  KO
K04851  voltage-dependent calcium channel L type alpha-1D
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04020  Calcium signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04024  cAMP signaling pathway
mmu04218  Cellular senescence
mmu04260  Cardiac muscle contraction
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04270  Vascular smooth muscle contraction
mmu04530  Tight junction
mmu04713  Circadian entrainment
mmu04723  Retrograde endocannabinoid signaling
mmu04724  Glutamatergic synapse
mmu04725  Cholinergic synapse
mmu04726  Serotonergic synapse
mmu04727  GABAergic synapse
mmu04728  Dopaminergic synapse
mmu04911  Insulin secretion
mmu04912  GnRH signaling pathway
mmu04921  Oxytocin signaling pathway
mmu04924  Renin secretion
mmu04925  Aldosterone synthesis and secretion
mmu04927  Cortisol synthesis and secretion
mmu04929  GnRH secretion
mmu04930  Type II diabetes mellitus
mmu04934  Cushing syndrome
mmu04935  Growth hormone synthesis, secretion and action
mmu04973  Carbohydrate digestion and absorption
mmu05010  Alzheimer disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05031  Amphetamine addiction
mmu05410  Hypertrophic cardiomyopathy
mmu05412  Arrhythmogenic right ventricular cardiomyopathy
mmu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    12289 (Cacna1d)
   04020 Calcium signaling pathway
    12289 (Cacna1d)
   04024 cAMP signaling pathway
    12289 (Cacna1d)
   04022 cGMP-PKG signaling pathway
    12289 (Cacna1d)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    12289 (Cacna1d)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    12289 (Cacna1d)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    12289 (Cacna1d)
   04929 GnRH secretion
    12289 (Cacna1d)
   04912 GnRH signaling pathway
    12289 (Cacna1d)
   04921 Oxytocin signaling pathway
    12289 (Cacna1d)
   04935 Growth hormone synthesis, secretion and action
    12289 (Cacna1d)
   04924 Renin secretion
    12289 (Cacna1d)
   04925 Aldosterone synthesis and secretion
    12289 (Cacna1d)
   04927 Cortisol synthesis and secretion
    12289 (Cacna1d)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    12289 (Cacna1d)
   04261 Adrenergic signaling in cardiomyocytes
    12289 (Cacna1d)
   04270 Vascular smooth muscle contraction
    12289 (Cacna1d)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    12289 (Cacna1d)
  09156 Nervous system
   04724 Glutamatergic synapse
    12289 (Cacna1d)
   04727 GABAergic synapse
    12289 (Cacna1d)
   04725 Cholinergic synapse
    12289 (Cacna1d)
   04728 Dopaminergic synapse
    12289 (Cacna1d)
   04726 Serotonergic synapse
    12289 (Cacna1d)
   04723 Retrograde endocannabinoid signaling
    12289 (Cacna1d)
  09159 Environmental adaptation
   04713 Circadian entrainment
    12289 (Cacna1d)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    12289 (Cacna1d)
   05020 Prion disease
    12289 (Cacna1d)
   05022 Pathways of neurodegeneration - multiple diseases
    12289 (Cacna1d)
  09165 Substance dependence
   05031 Amphetamine addiction
    12289 (Cacna1d)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    12289 (Cacna1d)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    12289 (Cacna1d)
   05414 Dilated cardiomyopathy
    12289 (Cacna1d)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    12289 (Cacna1d)
   04934 Cushing syndrome
    12289 (Cacna1d)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    12289 (Cacna1d)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   12289 (Cacna1d)
SSDB
Motif
Pfam: Ion_trans CAC1F_C Ca_chan_IQ GPHH PKD_channel Rer1
Other DBs
NCBI-GeneID: 12289
NCBI-ProteinID: NP_001289566
MGI: 88293
Ensembl: ENSMUSG00000015968
UniProt: Q99246
Position
14 A3- B; 14 18.43 cM
AA seq 2179 aa
MMMMMMMKKMQHQRQHQEDHANEANYARGTRLPISGEGPTSQPNSSKQTVLSWQAAIDAA
RQAKAAQTMSTSAPPPVGSLSQRKRQQYAKSKKQGNSSNSRPARALFCLSLNNPIRRACI
SIVEWKPFDIFILLAIFANCVALAIYIPFPEDDSNSTNHNLEKVEYAFLIIFTVETFLKI
IAYGLLLHPNAYVRNGWNLLDFVIVIVGLFSVILEQLTKETEGGNHSSGKSGGFDVKALR
AFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFIGKMHKT
CFFADSDIVAEEDPAPCAFSGNGRQCTANGTECRSGWVGPNGGITNFDNFAFAMLTVFQC
ITMEGWTDVLYWVNDAIGWEWPWVYFVSLIILGSFFVLNLVLGVLSGEFSKEREKAKARG
DFQKLREKQQLEEDLKGYLDWITQAEDIDPENEEEGGEEGKRNTSMPTSETESVNTENVS
GEGETQGCCGTLWCWWKRRGAAKTGPSGCRRWGQAISKSKLSRRWRRWNRFNRRRCRAAV
KSVTFYWLVIVLVFLNTLTISSEHYNQPDWLTQIQDIANKVLLALFTCEMLVKMYSLGLQ
AYFVSLFNRFDCFVVCGGITETILVELELMSPLGVSVFRCVRLLRIFKVTRHWTSLSNLV
ASLLNSMKSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDETQTKRSTFDNFPQALLTVFQ
ILTGEDWNAVMYDGIMAYGGPSSSGMIVCIYFIILFICGNYILLNVFLAIAVDNLADAES
LNTAQKEEAEEKERKKIARKESLENKKNNKPEVNQIANSDNKVTIDDYQEDAEDKDPYPP
CDVPVGEEEEEEEEDEPEVPAGPRPRRISELNMKEKIAPIPEGSAFFILSKTNPIRVGCH
KLINHHIFTNLILVFIMLSSAALAAEDPIRSHSFRNTILGYFDYAFTAIFTVEILLKMTT
FGAFLHKGAFCRNYFNLLDMLVVGVSLVSFGIQSSAISVVKILRVLRVLRPLRAINRAKG
LKHVVQCVFVAIRTIGNIMIVTTLLQFMFACIGVQLFKGKFYRCTDEAKSNPEECRGLFI
LYKDGDVDSPVVRERIWQNSDFNFDNVLSAMMALFTVSTFEGWPALLYKAIDSNGENVGP
VYNYRVEISIFFIIYIIIVAFFMMNIFVGFVIVTFQEQGEKEYKNCELDKNQRQCVEYAL
KARPLRRYIPKNPYQYKFWYVVNSSPFEYMMFVLIMLNTLCLAMQHYEQSKMFNDAMDIL
NMVFTGVFTVEMVLKVIAFKPKGYFSDAWNTFDSLIVIGSIIDVALSEADPSESETIPLP
TATPGNSEESNRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIAML
FFIYAVIGMQMFGKVAMRDNNQINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACLPGKL
CDPDSDYNPGEEYTCGSNFAIVYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPH
HLDEFKRIWSEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVAMNMPLNS
DGTVMFNATLFALVRTALKIKTEGNLEQANEELRAVIKKIWKKTSMKLLDQVVPPAGDDE
VTVGKFYATFLIQDYFRKFKKRKEQGLVGKYPAKNTTIALQAGLRTLHDIGPEIRRAISC
DLQDDEPEDSKPEEEDVFKRNGALLGNHVNHVNSDRRDSLQQTNTTHRPLHVQRPSMPPA
SDTEKPLFPPAGNSGCHNHHNHNSIGKQAPTSTNANLNNANMSKAAHGKPPSIGNLEHVS
ENGHYSCKHDRELQRRSSIKRTRYYETYIRSESGDEQFPTICREDPEIHGYFRDPRCLGE
QEYFSSEECCEDDSSPTWSRQNYNYYNRYPGSSMDFERPRGYHHPQGFLEDDDSPTGYDS
RRSPRRRLLPPTPPSHRRSSFNFECLRRQSSQDDVLPSPALPHRAALPLHLMQQQIMAVA
GLDSSKAQKYSPSHSTRSWATPPATPPYRDWSPCYTPLIQVDRSESMDQVNGSLPSLHRS
SWYTDEPDISYRTFTPASLTVPSSFRNKNSDKQRSADSLVEAVLISEGLGRYARDPKFVS
ATKHEIADACDLTIDEMESAASTLLNGSVCPRANGDMGPISHRQDYELQDFGPGYSDEEP
DPGREEEDLADEMICITTL
NT seq 6540 nt   +upstreamnt  +downstreamnt
atgatgatgatgatgatgatgaaaaaaatgcaacatcaacggcagcaccaagaggaccat
gcgaacgaggcaaactatgcaagaggcaccagactccctatttctggtgaaggaccaact
tctcagcccaacagctccaagcaaactgtcctatcttggcaagctgcaatcgatgctgct
agacaggccaaggccgcccagaccatgagcacctctgcacccccacctgtaggatctctc
tcccaaagaaaacgtcagcaatacgccaagagcaaaaaacagggtaactcgtctaacagc
cgacctgcccgtgcccttttctgtttatccctcaataaccccatccgaagagcctgcatt
agtatagtggaatggaaaccatttgacatatttatattattggctatttttgccaattgt
gtggccttagctatttacatcccattccctgaagatgattctaattcaacaaatcataac
ttggaaaaagtagaatatgccttcctgattatttttacagtggagacatttctgaagatt
atagcgtatggactgttgctgcatcctaatgcttacgttaggaatggatggaatttactg
gattttgttatagtaattgtaggattgtttagtgtaattctggaacaattaaccaaagaa
acagaaggcgggaaccactctagtggcaaatcaggaggctttgatgtcaaagccctccgt
gccttccgagtgttaagaccacttcgacttgtatcaggagtgcccagtttacaagttgtt
ctgaactccattataaaagccatggtccccctccttcacatagcccttttggtattattt
gtaattatcatctatgctattataggattggaactttttattggaaaaatgcacaaaaca
tgtttttttgctgactcagatatagtagctgaagaggacccagctccgtgtgcgttctca
gggaatggacgccagtgcaccgccaatggcacggaatgtaggagtggctgggttggcccc
aatggaggcatcactaactttgataactttgcctttgccatgctcactgtgttccagtgc
attaccatggagggctggacagatgtgctctactgggttaatgatgcgataggatgggaa
tggccatgggtgtattttgttagtctgatcatccttggctcatttttcgtccttaacctg
gttcttggtgtccttagtggagaattctccaaggaaagagagaaggctaaagctcgtgga
gatttccagaagcttcgggaaaaacagcagctggaagaggacctcaagggctacctggac
tggatcacccaggcagaagacatcgatcccgagaacgaggaggagggtggcgaggaaggc
aaacgaaacactagcatgcccaccagcgagactgaatctgtcaacacagagaacgtaagt
ggtgaaggcgagacccagggatgctgtggaactctctggtgctggtggaaaagaagaggc
gcggccaagaccgggccctctgggtgtcggcggtggggtcaggccatctcgaaatccaaa
ctcagccgtcgatggcgtcgctggaaccggttcaatcgcaggaggtgcagggctgccgtg
aagtctgtcacgttttactggctggtgattgtcctggtgtttctcaacactttaactatt
tcctctgagcattacaatcagccagactggctgacacagattcaagacatcgcaaacaaa
gtcctcttggctctgttcacctgtgagatgctggtgaagatgtacagcctgggcctccag
gcttactttgtctccctcttcaaccgcttcgattgctttgtggtgtgtgggggcatcacc
gaaaccatcctggtggaactggagctcatgtctcccctgggggtctccgtgttccggtgt
gtgcgcctcctgagaatcttcaaagtgaccaggcactggacctccctgagcaacttggtg
gcatccttgttaaactccatgaagtccatcgcctctctgctgttactcctcttcctcttc
atcatcatcttctccttgctggggatgcagttgtttggtgggaagtttaattttgacgag
actcaaaccaagcgaagcacctttgacaactttccgcaagcactcctgacggtgttccag
atcctgacaggtgaagactggaatgcggtgatgtatgacggcatcatggcctatggaggc
ccttcctcttccgggatgattgtctgtatctacttcatcatccttttcatctgtggtaac
tatatcctgctgaatgtcttcttggccatcgctgtggacaatttggctgatgctgaaagt
ctgaacactgctcagaaagaggaagctgaagaaaaagaaaggaaaaagattgccagaaaa
gaaagcctagaaaacaaaaagaacaacaaaccagaagtcaaccagatagccaacagtgac
aacaaggttacaattgatgattatcaggaagatgctgaagacaaggacccttacccgccc
tgtgatgtgccagtaggtgaagaggaagaggaggaggaagaggatgagcccgaagttcct
gctggtccccgccctcgcagaatctcagagttgaacatgaaggagaagattgcgcccatc
ccagaaggaagcgccttcttcattcttagcaagaccaacccgatacgtgtgggttgccac
aagctcattaaccaccacatcttcaccaaccttatcctggtcttcatcatgctgagcagc
gctgccctggctgcagaggaccccatccgtagccactcattccgcaacacgatactgggc
tactttgactatgccttcacagccatctttacggttgaaatcctgttaaagatgacaact
tttggagccttcttgcacaaaggggctttctgcaggaactacttcaatttgctggacatg
ctggttgttggggtgtcgctggtgtcctttgggattcagtccagcgccatctccgttgtg
aagattctgagggttttgagggtcttgcggcctctcagagcaatcaacagagcaaaggga
cttaagcacgtggtccagtgtgtctttgtggccatccgaaccattggcaacatcatgatc
gtcacgaccctgctccagttcatgtttgcatgcattggggtccagctgttcaaggggaag
ttctaccgttgcacagatgaagccaaaagtaaccctgaggagtgcagggggcttttcatt
ctttataaggacggcgatgttgacagtcctgtggtccgtgagaggatctggcaaaatagt
gatttcaattttgacaatgtcctttcggctatgatggcgctgttcacagtctcaactttt
gagggctggcccgcgttgctgtacaaagctattgattcaaacggtgagaacgttggtcct
gtctacaactaccgtgtggagatctccatcttcttcatcatctacatcatcatcgttgcc
ttcttcatgatgaacatctttgtgggcttcgtcatcgtcaccttccaggaacagggagaa
aaagagtataagaactgtgagctggacaaaaatcagcgtcagtgtgttgaatatgccttg
aaagcacgccccttaaggagatacatccccaaaaacccataccagtacaagttctggtat
gtggtgaactcctcgcctttcgaatacatgatgttcgtcctcatcatgctcaacacgctc
tgcctggccatgcagcactatgagcagtccaagatgttcaatgatgccatggacattctg
aacatggtcttcacaggggtcttcactgttgagatggttttgaaagtcattgctttcaag
cccaaggggtattttagtgacgcctggaacacgtttgactccctcatcgtaatcggcagc
attatagacgtggccctcagcgaagccgacccatctgaaagtgagactatccctctccca
actgccacacctgggaactctgaagagagcaatagaatctccatcacctttttccgtctt
ttccgagtgatgcggttggtgaaacttctcagcaggggggaaggcatccggacactgctg
tggaccttcatcaagtcctttcaggcgctgccgtatgttgccctcctcattgccatgctc
ttcttcatctacgctgtcataggcatgcagatgtttgggaaagttgccatgagagataac
aaccagatcaataggaacaacaacttccagacctttcctcaggcagtgctcctactcttc
aggtgtgcaacaggggaagcctggcaggagatcatgcttgcctgcctcccaggaaagctg
tgcgacccagactccgattacaacccaggagaggagtacacttgtgggagcaactttgcc
attgtctacttcatcagcttttacatgctctgtgcattcctgatcatcaacctctttgtg
gctgtcatcatggacaattttgactatctgactcgggactggtctattctggggcctcac
cacttggacgaattcaaaagaatatggtcagaatatgaccctgaagcaaagggaaggata
aaacaccttgatgtggtcactctgctccggcggatccagcctcccctggggtttggaaaa
ttatgcccacaccgagtagcatgtaagagattggttgccatgaacatgcctctcaacagt
gatgggacagtcatgttcaatgcaaccctgtttgctttggtccggacagctctcaagatc
aagactgaagggaacctggagcaagctaatgaagaactccgagctgtgatcaagaaaatc
tggaagaagacaagcatgaagctgcttgaccaagttgtccctccagctggtgatgatgag
gtaaccgtggggaagttctatgccactttcctgatacaggactactttaggaaattcaag
aaacggaaagagcaaggactggtggggaagtaccctgcgaagaacaccacgattgcccta
caggcgggattaaggaccctgcatgacattgggccagaaatccgacgggctatatcctgt
gacttgcaagatgacgagccagaagactccaaaccagaagaagaagatgtattcaaaaga
aatggtgccctgcttggaaaccatgtcaatcatgttaatagtgataggagagattccctt
cagcagaccaataccacccaccgtcccctgcatgtccaaaggccttcaatgccacctgca
agtgatactgagaaaccgctgtttcctccagcaggaaattcggggtgtcataaccatcat
aaccataattccatagggaagcaagctcccacctcaacaaatgccaatctcaataatgcc
aatatgtccaaagctgcccacggaaagccgcccagcattgggaaccttgagcatgtgtct
gaaaatgggcattactcctgcaagcatgatcgagagcttcaaagaaggtccagtattaaa
agaacccgctattacgagacttacattaggtctgagtcaggagatgagcaatttccaacc
atttgccgtgaagatcctgagatacacggctacttccgagacccccgctgcttgggggaa
caggagtatttcagtagcgaggagtgctgtgaggacgacagctctcccacctggagcagg
caaaactacaactactacaacaggtacccaggcagctccatggactttgagaggccccga
ggctaccaccacccccaaggcttcttagaagatgatgactctcccactggctatgattca
cggagatctccgaggagacgtcttctacctcctaccccaccatcccatcggaggtcctcc
ttcaactttgagtgtctgcgcaggcaaagcagccaagacgatgtccttccatcgcctgcc
ctgcctcaccgcgctgccctgcccctgcacctgatgcagcagcagatcatggccgttgca
ggcctagattccagtaaagcccagaagtactcaccgagccactctacccggtcgtgggcc
acccctccagcaacccctccataccgagactggagcccatgctacacccctttgatccag
gtggaccgctcagaatctatggaccaggtcaatggcagcctgccatccctacaccgaagc
tcctggtacacagatgaacccgacatctcctataggactttcacgccagctagtctgact
gtccccagcagcttccggaacaagaacagcgacaagcagaggagtgcagacagcctggtg
gaggcagtcctgatatccgaaggcttgggacgctacgcgagggaccccaaatttgtctca
gcgacaaaacatgagattgccgatgcctgtgacctaaccatagacgagatggaaagtgct
gccagcaccctgctcaatggcagtgtgtgtcctcgagccaatggggacatgggccccatc
tcccaccgccaggactatgagctccaggactttggtcctggctacagtgacgaggagcca
gaccctgggcgagaggaagaggacctggcagatgagatgatttgcattaccaccttgtag

KEGG   Mus musculus (mouse): 12292
Entry
12292             CDS       T01002                                 

Gene name
Cacna1s, AW493108, Cav1, Cav1.1, Cchl1, Cchl1a3, DHPR, DHPR_alpha1s, fmd, mdg, s, sj
Definition
(RefSeq) calcium channel, voltage-dependent, L type, alpha 1S subunit
  KO
K04857  voltage-dependent calcium channel L type alpha-1S
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04020  Calcium signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04024  cAMP signaling pathway
mmu04260  Cardiac muscle contraction
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04270  Vascular smooth muscle contraction
mmu04723  Retrograde endocannabinoid signaling
mmu04725  Cholinergic synapse
mmu04726  Serotonergic synapse
mmu04727  GABAergic synapse
mmu04911  Insulin secretion
mmu04912  GnRH signaling pathway
mmu04921  Oxytocin signaling pathway
mmu04924  Renin secretion
mmu04925  Aldosterone synthesis and secretion
mmu04927  Cortisol synthesis and secretion
mmu04929  GnRH secretion
mmu04934  Cushing syndrome
mmu04935  Growth hormone synthesis, secretion and action
mmu05010  Alzheimer disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05410  Hypertrophic cardiomyopathy
mmu05412  Arrhythmogenic right ventricular cardiomyopathy
mmu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    12292 (Cacna1s)
   04020 Calcium signaling pathway
    12292 (Cacna1s)
   04024 cAMP signaling pathway
    12292 (Cacna1s)
   04022 cGMP-PKG signaling pathway
    12292 (Cacna1s)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    12292 (Cacna1s)
   04929 GnRH secretion
    12292 (Cacna1s)
   04912 GnRH signaling pathway
    12292 (Cacna1s)
   04921 Oxytocin signaling pathway
    12292 (Cacna1s)
   04935 Growth hormone synthesis, secretion and action
    12292 (Cacna1s)
   04924 Renin secretion
    12292 (Cacna1s)
   04925 Aldosterone synthesis and secretion
    12292 (Cacna1s)
   04927 Cortisol synthesis and secretion
    12292 (Cacna1s)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    12292 (Cacna1s)
   04261 Adrenergic signaling in cardiomyocytes
    12292 (Cacna1s)
   04270 Vascular smooth muscle contraction
    12292 (Cacna1s)
  09156 Nervous system
   04727 GABAergic synapse
    12292 (Cacna1s)
   04725 Cholinergic synapse
    12292 (Cacna1s)
   04726 Serotonergic synapse
    12292 (Cacna1s)
   04723 Retrograde endocannabinoid signaling
    12292 (Cacna1s)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    12292 (Cacna1s)
   05020 Prion disease
    12292 (Cacna1s)
   05022 Pathways of neurodegeneration - multiple diseases
    12292 (Cacna1s)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    12292 (Cacna1s)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    12292 (Cacna1s)
   05414 Dilated cardiomyopathy
    12292 (Cacna1s)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    12292 (Cacna1s)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    12292 (Cacna1s)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   12292 (Cacna1s)
SSDB
Motif
Pfam: Ion_trans GPHH Ca_chan_IQ PKD_channel CAC1F_C
Other DBs
NCBI-GeneID: 12292
NCBI-ProteinID: NP_001074492
MGI: 88294
Ensembl: ENSMUSG00000026407
Vega: OTTMUSG00000033761
UniProt: F8VQE0
Position
1 E4; 1 59.55 cM
AA seq 1852 aa
MEPPSPQDEGLRKKQPKKPVPEILPRPPRALFCLTLQNPLRKACISIVEWKPFETIILLT
IFANCVALAVYLPMPEDDNNTLNLGLEKLEYFFLIVFSIEAAMKIIAYGFLFHQDAYLRS
GWNVLDFIIVFLGVFTVILEQVNIIQTNTAPMSSKGAGLDVKALRAFRVLRPLRLVSGVP
SLQVVLNSIFKAMLPLFHIALLVLFMVIIYAIIGLELFKGKMHKTCYFIGTDIVATVENE
KPSPCARTGSGRPCTINGSECRGGWPGPNHGITHFDNFGFSMLTVYQCISMEGWTDVLYW
VNDAIGNEWPWIYFVTLILLGSFFILNLVLGVLSGEFTKEREKAKSRGTFQKLREKQQLE
EDLRGYMSWITQGEVMDVDDLREGKLSLDEGGSDTESLYEIEGLNKIIQFIRHWRQWNRV
FRWKCHDLVKSKVFYWLVILIVALNTLSIASEHHNQPLWLTHLQDVANRVLLTLFTIEML
MKMYGLGLRQYFMSIFNRFDCFVVCSGILEILLVESGAMSPLGISVLRCIRLLRLFKITK
YWTSLSNLVASLLNSIRSIASLLLLLFLFIIIFALLGMQLFGGRYDFEDTEVRRSNFDNF
PQALISVFQVLTGEDWNSVMYNGIMAYGGPTYPGVLVCIYFIILFVCGNYILLNVFLAIA
VDNLAEAESLTSAQKAKAEERKRRKMSKGLPDKSEEERATVTKKLEQKSKGEGIPTTAKL
KIDEFESNVNEVKDPYPSADFPGDDEEDEPEIPVSPRPRPLAELQLKEKAVPIPEASSFF
IFSPTNKIRVLCHRIVNATWFTNFILLFILLSSAALAAEDPIRADSMRNQILEYFDYVFT
AVFTVEIVLKMTTYGAFLHKGSFCRNYFNILDLLVVAVSLISMGLESSAISVVKILRVLR
VLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVLVTTLLQFMFACIGVQLFKGKFYSCNDL
SKMTEEECRGYYYIYKDGDPTQIELRPRQWIHNDFHFDNVLSAMMSLFTVSTFEGWPQLL
YKAIDSNEEDTGPVYNNRVEMAIFFIIYIILIAFFMMNIFVGFVIVTFQEQGETEYKNCE
LDKNQRQCVQYALKARPLRCYIPKNPYQYQVWYVVTSSYFEYLMFALIMLNTICLGMQHY
NQSEQMNHISDILNVAFTIIFTLEMVLKLIAFKPRGYFGDPWNVFDFLIVIGSIIDVILS
EIDTFLASSGGLYCLGGGCGNVDPDESARISSAFFRLFRVMRLVKLLNRAEGVRTLLWTF
IKSFQALPYVALLIVMLFFIYAVIGMQMFGKIAMVDGTQINRNNNFQTFPQAVLLLFRCA
TGEAWQEILLACSYGKLCDPESDYAPGEEHTCGTNFAYYYFISFYMLCAFLIINLFVAVI
MDNFDYLTRDWSILGPHHLDEFKAIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKFCP
HRVACKRLVGMNMPLNSDGTVTFNATLFALVRTALKIKTEGNFEQANEELRAIIKKIWKR
TSMKLLDQVIPPIGDDEVTVGKFYATFLIQEHFRKFMKRQEEYYGYRPKKDTVQIQAGLR
TIEEEAAPEIHRAISGDLTAEEELERAMVEAAMEEGIFRRTGGLFGQVDNFLERTNSLPP
VMANQRPLQFAEIEMEELESPVFLEDFPQNPGTHPLARANTNNANANVAYGNSSHRNNPV
FSSICYEREFLGEADMPVTREGPLSQPCRASGPHSRSHVDKLKRPMTQRGMPEGQVPPSP
CQVTGAKAEHPVQKEGKGPTSRFLETPNSRNFEEHVPRNSAHRCTAPATAMLIQEALVRG
GLDSLAADANFVMATGQALADACQMEPEEVEVAATELLKQESPEGGAVPWEP
NT seq 5559 nt   +upstreamnt  +downstreamnt
atggagccgccctcaccccaggacgagggcctgaggaagaagcagccgaagaaacctgtt
cctgagattctgccgaggcccccgcgggccttgttctgcctgactctacagaaccccctg
aggaaggcctgcatcagcatcgtggaatggaaacccttcgagaccatcatcttgctcacc
atctttgccaactgtgtggccctggcagtgtacctgcccatgccagaggatgacaacaac
actctgaacctcggcctggagaaactggagtacttcttcctcattgtcttctccattgaa
gccgccatgaagatcatagcctacggcttcctattccatcaggatgcatacctgcgcagt
ggctggaacgttctggacttcatcattgtctttctgggggtcttcactgtgattctggaa
caagttaacatcattcaaaccaacacggcccccatgagcagcaaaggagccggcttggat
gtgaaggcccttcgagcattccgcgtgctcagacccctgcggctggtgtcgggggtgccc
agtcttcaggtggtcctcaactccatcttcaaggccatgctccccctgttccacattgcc
ctgctcgtcctcttcatggtcatcatctacgccatcattgggctggagctcttcaaaggc
aagatgcacaagacttgctacttcattgggacagacattgtagccacagttgagaatgag
aaaccatcaccctgtgctagaactggctctgggcgtccctgcaccatcaatggcagcgag
tgccgaggaggttggccaggacccaaccacggcatcacccacttcgacaactttggcttc
tctatgctcactgtgtatcaatgcatctccatggaggggtggactgatgtcctgtactgg
gtcaacgatgccatcgggaatgagtggccctggatctactttgtcaccctcattctgctg
ggctccttcttcatcctcaacctggtgctgggtgtcctgagtggagaattcaccaaagag
cgagagaaggccaagtccaggggaaccttccaaaagctccgagagaaacagcagctggag
gaggacctccgtggttacatgagctggatcacacagggcgaggtcatggacgtggacgac
ttgagagaaggcaagctgtctttggatgaagggggatcagacacagagagcttgtatgaa
atcgaaggcttgaacaaaatcatccagttcattcggcactggcgacagtggaatcgcgtc
ttccgctggaagtgccatgacctagtgaaatccaaggtcttctattggctggtgatcctg
atcgttgccctaaacaccctgtccattgcctcggagcaccacaaccagccactctggttg
acccatttgcaagatgttgccaaccgcgtgttgctgaccctcttcaccatcgaaatgctc
atgaagatgtacgggctgggcctgcgccagtacttcatgtccatcttcaaccgcttcgac
tgcttcgtggtgtgcagcggcatcctggagatcctgctggtggagtcgggagccatgtcg
cccctgggcatctctgtgctccgctgtatccgcctcctgaggctcttcaagatcaccaag
tactggacatcgctgagcaacctggtggcctcactgctcaactccatccgctccattgct
tccctcttgctgctgctctttctcttcatcatcatctttgccctgctgggcatgcagctc
tttggaggcagatatgactttgaagacacagaagtacgacgaagcaactttgacaacttc
ccccaggccctcatcagtgtcttccaggtcctgacgggtgaagactggaactctgtgatg
tacaatgggatcatggcttacggaggtccgacctaccctggtgtgctggtgtgcatttat
ttcatcatccttttcgtctgtggcaactacatccttctcaacgtcttcctggctattgct
gtggacaacctggcagaggcagagagtctgacatctgcccaaaaggccaaggctgaggag
agaaagcgcaggaagatgtcgaaagggctcccagacaagtcagaagaggagagggccacg
gtgaccaagaaactggagcagaagtccaagggtgaaggcatccccaccaccgccaagctg
aaaatcgatgagtttgaatcaaacgttaatgaggtgaaagacccctacccttcggctgac
ttcccaggggacgatgaggaagatgagcccgagatcccagtgagcccccgaccacgccct
ctggccgagctgcagctgaaagagaaagcagtgcccatcccggaggctagctccttcttc
atcttcagtcccaccaacaagatccgtgtcctgtgtcaccgcattgtcaatgccacctgg
ttcaccaacttcatcctgctcttcatcctgctcagcagtgccgccctggccgctgaggat
cccatccgggccgactccatgaggaatcagatcctcgagtattttgattatgtgttcact
gctgttttcacggtggagattgtccttaagatgaccacctatggagccttcctgcacaaa
ggctccttctgccgcaactacttcaacatcctggacctgctggtggtggctgtgtccctc
atctccatgggcctcgagtccagcgccatctccgtggtgaagatcttaagggttctgaga
gtgctgagaccactccgggccataaacagagccaaagggttgaagcacgtggtgcagtgc
gtgtttgttgccattcgcaccatcgggaacatcgtgctggtcaccacgctcctgcagttc
atgtttgcgtgcattggagtgcagcttttcaagggaaagttctacagctgcaatgactta
tccaagatgactgaagaggaatgcaggggctactactacatatacaaggatggagacccc
actcagatagagctgcgtccccgccagtggatacacaatgacttccactttgacaatgta
ctctccgctatgatgtcactcttcacggtctccaccttcgagggttggcctcagctactg
tacaaggccatagactcaaatgaggaggacaccggccctgtctacaacaaccgagtggag
atggccatcttcttcattatctacatcatcctcattgccttcttcatgatgaacatcttt
gtgggctttgtcatcgttaccttccaggaacagggagagactgagtataagaactgtgag
ctcgacaagaaccagcgccaatgcgtacagtatgccctgaaggcccgcccactgaggtgt
tacatccccaaaaacccataccagtatcaggtgtggtatgtcgtcacttcctcctacttt
gaatacctgatgtttgctctcatcatgctcaatactatctgcctgggcatgcagcattac
aaccagtcggaacagatgaaccacatctcagacattctcaacgtggctttcaccatcatc
ttcaccctggagatggtcctcaagctcatagctttcaagcccaggggctattttggagat
ccttggaatgtgtttgacttcctaatcgtcatcggcagcatcattgacgtcatcctgagc
gagatcgatactttcctggcctccagcgggggactgtattgcctgggtggaggctgcggg
aacgttgacccagatgagagcgcccgtatctccagtgccttcttccgcctgttccgggtc
atgagactggtcaagctgctgaaccgggcggagggtgtgcgcaccctgctgtggacattc
atcaagtccttccaggccctgccgtacgtggctttgctgatcgtgatgctcttcttcatc
tacgcggtcatcggcatgcagatgttcgggaagatcgccatggtggacgggacgcagata
aaccggaacaacaacttccagactttcccacaggccgtgctgctgctcttcaggtgtgcc
acaggggaagcctggcaagagatcctgctggcctgcagctatgggaagctgtgtgacccg
gagtctgactacgcacccggggaggagcatacatgcggcaccaacttcgcctactactac
ttcatcagtttctacatgctctgcgccttcctgatcatcaacctctttgtggctgtcatc
atggacaactttgattacctcacaagggactggtccattctgggccctcaccacctggac
gagttcaaggccatttgggctgagtacgacccggaggctaagggcaggatcaagcacctg
gatgtggtgaccctgctgaggaggattcagccccctctgggctttgggaagttctgccca
cacagggtagcatgtaagaggctggtgggcatgaacatgcccctgaacagcgatggcaca
gtcacctttaatgccacactatttgccctggtgcgcacagccctcaagatcaagacagaa
ggcaactttgaacaagctaacgaggagctgagagccatcatcaagaagatctggaagaga
accagcatgaagctcttggaccaagtcatccctccaataggagatgatgaggtgacagta
gggaaattctatgccacattcctcatccaggagcacttccggaagttcatgaagcgccag
gaggaatattatgggtatcgacccaaaaaggacacagttcagatacaggctggattacgg
accatagaggaagaggcagctcctgagatccaccgtgccatctctggagacctgacagca
gaggaggaactggagagggccatggtagaggctgccatggaggaggggatattccggagg
acgggaggcctgtttggtcaagtggacaacttcctggaaaggaccaactctctgccccct
gtcatggccaaccaaagacccctccaatttgctgaaatagagatggaagagctggagtca
ccagtcttcttggaggacttccctcagaacccaggcacccaccctcttgctcgtgccaat
accaacaacgccaatgccaatgttgcctatggcaacagcagccatagaaacaacccagtg
ttttccagcatctgctatgaacgggagttcttgggagaggcggacatgcctgttaccaga
gaaggacccctcagtcagccctgcagggcctcaggacctcacagcagatctcatgtggac
aaactgaaaagaccgatgacccagagaggaatgcctgaaggccaggtgcctccttccccg
tgccaggtaacaggggcaaaagcagagcatcctgtgcagaaagagggaaagggccccacg
tcacggtttctggaaacacccaacagcaggaactttgaggagcacgttcccaggaattcg
gctcacaggtgcacggctccagctactgccatgctgatccaggaggctctggttcgagga
ggactagactccttagcagcagatgctaacttcgtcatggcaacaggccaggccctggca
gatgcctgccagatggaaccagaggaagtcgaggtggcagcaacagagctactgaagcaa
gaatccccagagggcggggccgtgccctgggagccttga

KEGG   Mus musculus (mouse): 54652
Entry
54652             CDS       T01002                                 

Gene name
Cacna1f, A930034B14, Cav1, Cav1.4, Sfc1, Sfc17, nerg1, nob2
Definition
(RefSeq) calcium channel, voltage-dependent, alpha 1F subunit
  KO
K04853  voltage-dependent calcium channel L type alpha-1F
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04020  Calcium signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04024  cAMP signaling pathway
mmu04260  Cardiac muscle contraction
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04270  Vascular smooth muscle contraction
mmu04723  Retrograde endocannabinoid signaling
mmu04725  Cholinergic synapse
mmu04726  Serotonergic synapse
mmu04727  GABAergic synapse
mmu04911  Insulin secretion
mmu04912  GnRH signaling pathway
mmu04921  Oxytocin signaling pathway
mmu04924  Renin secretion
mmu04925  Aldosterone synthesis and secretion
mmu04927  Cortisol synthesis and secretion
mmu04929  GnRH secretion
mmu04934  Cushing syndrome
mmu04935  Growth hormone synthesis, secretion and action
mmu05010  Alzheimer disease
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05410  Hypertrophic cardiomyopathy
mmu05412  Arrhythmogenic right ventricular cardiomyopathy
mmu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    54652 (Cacna1f)
   04020 Calcium signaling pathway
    54652 (Cacna1f)
   04024 cAMP signaling pathway
    54652 (Cacna1f)
   04022 cGMP-PKG signaling pathway
    54652 (Cacna1f)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    54652 (Cacna1f)
   04929 GnRH secretion
    54652 (Cacna1f)
   04912 GnRH signaling pathway
    54652 (Cacna1f)
   04921 Oxytocin signaling pathway
    54652 (Cacna1f)
   04935 Growth hormone synthesis, secretion and action
    54652 (Cacna1f)
   04924 Renin secretion
    54652 (Cacna1f)
   04925 Aldosterone synthesis and secretion
    54652 (Cacna1f)
   04927 Cortisol synthesis and secretion
    54652 (Cacna1f)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    54652 (Cacna1f)
   04261 Adrenergic signaling in cardiomyocytes
    54652 (Cacna1f)
   04270 Vascular smooth muscle contraction
    54652 (Cacna1f)
  09156 Nervous system
   04727 GABAergic synapse
    54652 (Cacna1f)
   04725 Cholinergic synapse
    54652 (Cacna1f)
   04726 Serotonergic synapse
    54652 (Cacna1f)
   04723 Retrograde endocannabinoid signaling
    54652 (Cacna1f)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    54652 (Cacna1f)
   05020 Prion disease
    54652 (Cacna1f)
   05022 Pathways of neurodegeneration - multiple diseases
    54652 (Cacna1f)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    54652 (Cacna1f)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    54652 (Cacna1f)
   05414 Dilated cardiomyopathy
    54652 (Cacna1f)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    54652 (Cacna1f)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    54652 (Cacna1f)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   54652 (Cacna1f)
SSDB
Motif
Pfam: Ion_trans CAC1F_C Ca_chan_IQ GPHH PKD_channel DUF3682
Other DBs
NCBI-GeneID: 54652
NCBI-ProteinID: NP_062528
MGI: 1859639
Ensembl: ENSMUSG00000031142
Vega: OTTMUSG00000017707
UniProt: Q7TNI3
Position
X A1.1; X 3.42 cM
AA seq 1984 aa
MSESEVGKDTTPEPSPANGTGPGPEWGLCPGPPTVGTDTSGASGLGTPRRRTQHNKHKTV
AVASAQRSPRALFCLTLTNPIRRSCISIVEWKPFDILILLTIFANCVALGVYIPFPEDDS
NTANHNLEQVEYVFLVIFTVETVLKIVAYGLVLHPSAYIRNGWNLLDFIIVVVGLFSVLL
EQGPGRPGDAPHTGGKPGGFDVKALRAFRVLRPLRLVSGVPSLHIVLNSIMKALVPLLHI
ALLVLFVIIIYAIIGLELFLGRMHKTCYFLGSDMEAEEDPSPCASSGSGRSCTLNHTECR
GRWPGPNGGITNFDNFFFAMLTVFQCITMEGWTDVLYWMQDAMGYELPWVYFVSLVIFGS
FFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQMEEDLRGYLDWITQAEELDLHDPS
VDGNLASLAEEGRAGHRPQLSELTNRRRGRLRWFSHSTRSTHSTSSHASLPASDTGSMTD
TPGDEDEEEGTMASCTRCLNKIMKTRICRHFRRANRGLRARCRRAVKSNACYWAVLLLVF
LNTLTIASEHHGQPLWLTQTQEYANKVLLCLFTVEMLLKLYGLGPSVYVASFFNRFDCFV
VCGGILETTLVEVGAMQPLGISVLRCVRLLRIFKVTRHWASLSNLVASLLNSMKSIASLL
LLLFLFIIIFSLLGMQLFGGKFNFDQTHTKRSTFDTFPQALLTVFQILTGEDWNVVMYDG
IMAYGGPFFPGMLVCVYFIILFICGNYILLNVFLAIAVDNLASGDAGTAKDKGREKSSEG
NPPKENKVLVPGGENEDAKGARSEGAAPGMEEEEEEEEEEEEEEEEENGAGHVELLQEVV
PKEKVVPIPEGSAFFCLSQTNPLRKACHTLIHHHIFTSLILVFIILSSVSLAAEDPIRAH
SFRNHILGYFDYAFTSIFTVEILLKMTVFGAFLHRGSFCRSWFNLLDLLVVSVSLISFGI
HSSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIMIVTTLLQFMFACI
GVQLFKGKFYSCTDEAKHTLKECKGSFLIYPDGDVSRPLVRERLWVNSDFNFDNVLSAMM
ALFTVSTFEGWPALLYKAIDANAEDEGPIYNYHVEISVFFIVYIIIIAFFMMNIFVGFVI
ITFRAQGEQEYQNCELDKNQRQCVEYALKAQPLRRYIPKNPHQYRVWATVNSAAFEYLMF
LLILLNTVALAMQHYEQTAPFNYAMDILNMVFTGLFTIEMVLKIIAFKPKHYFADAWNTF
DALIVVGSVVDIAVTEVNNGGHLGESSEDSSRISITFFRLFRVMRLVKLLSKGEGIRTLL
WTFIKSFQALPYVALLIAMIFFIYAVIGMQMFGKVALQDGTQINRNNNFQTFPQAVLLLF
RCATGEAWQEIMLASLPGNRCDPESDFGPGEEFTCGSSFAIVYFISFFMLCAFLIINLFV
AVIMDNFDYLTRDWSILGPHHLDEFKRIWSEYDPGAKGRIKHLDVVALLRRIQPPLGFGK
LCPHRVACKRLVAMNVPLNSDGTVTFNATLFALVRTSLKIKTEGNLDQANQELRMVIKKI
WKRIKQKLLDEVIPPPDEEEVTVGKFYATFLIQDYFRKFRRRKEKGLLGREAPTSTSSAL
QAGLRSLQDLGPEIRQALTYDTEEEEEEEEAVGQEAEEEEAENNPEPYKDSIDSQPQSRW
NSRISVSLPVKEKLPDSLSTGPSDDDGLAPNSRQPSVIQAGSQPHRRSSGVFMFTIPEEG
SIQLKGTQGQDNQNEEQEVPDWTPDLDEQAGTPSNPVLLPPHWSQQHVNGHHVPRRRLLP
PTPAGRKPSFTIQCLQRQGSCEDLPIPGTYHRGRTSGPSRAQGSWAAPPQKGRLLYAPLL
LVEESTVGEGYLGKLGGPLRTFTCLQVPGAHPNPSHRKRGSADSLVEAVLISEGLGLFAQ
DPRFVALAKQEIADACHLTLDEMDSAASDLLAQRTTSLYSDEESILSRFDEEDLGDEMAC
VHAL
NT seq 5955 nt   +upstreamnt  +downstreamnt
atgtcggaatctgaagtcgggaaagatacaaccccagagcccagtccagccaatgggact
ggccctggccctgaatgggggctctgtcctgggcctccaactgtggggactgataccagc
ggggcgtcaggcctggggaccccaagaagaaggacccagcacaacaaacacaagactgtg
gcggtggccagtgctcagagatcacctcgagcgctcttctgcctcacccttactaatccc
attcgtcggtcctgcatcagcattgtagagtggaagccttttgatattctcatcctcctg
acaatctttgccaactgcgtggcattgggggtatatatccccttccctgaggacgactcc
aacactgctaaccacaacttggaacaggtagaatacgtgttcctggtgattttcaccgtg
gagacagtgctcaagatcgtagcctatgggctggtgctccatcccagcgcctatattcgc
aatggctggaacctgctcgacttcatcatcgtcgtggtcgggctgttcagcgtgctgctg
gaacaaggacctgggcggccaggagatgccccgcatactggaggaaagccaggaggcttc
gatgtaaaggcactgcgggcatttagggtgctacgacctctaaggctagtgtctggggtc
ccgagtctgcacatagtgctcaattccatcatgaaggcgcttgtgccgctgctgcacatt
gccctgttggtgctcttcgtcattatcatttacgccatcatcggactcgagctattcctc
ggacgaatgcacaagacatgctacttcctgggatctgatatggaagcagaggaggaccca
tcaccttgtgcatcttctggctctgggcgttcatgcacactgaaccataccgagtgccgc
gggcgctggccaggacccaacggtggcatcacgaacttcgacaattttttctttgccatg
ctaactgtgttccagtgtattaccatggaaggctggacagacgtcctctactggatgcag
gatgccatggggtatgagctgccttgggtgtactttgtgagccttgtcatctttgggtcc
ttctttgtcctcaaccttgtgcttggagtcctaagcggggagttctccaaggaaagagaa
aaggcaaaagcacgaggtgactttcagaagcttcgggagaagcagcagatggaagaagac
cttcggggctacctggactggatcacacaggctgaggagttagaccttcatgacccctca
gtagacggcaacttggcttctcttgctgaagagggacgggcgggccatcggccacaactg
tcagagctgaccaataggaggcgcggacggctgcgatggttcagccactctactcgctcc
acacactccaccagcagccacgccagcctcccagccagtgacactggctccatgacagac
acccctggagatgaggatgaagaagaggggaccatggctagctgtacacgctgcctaaac
aagattatgaaaacaaggatctgccgccacttccgccgagccaaccggggtctccgtgca
cgctgccgccgggccgtcaagtccaacgcctgctactgggctgtactgttgctcgtcttc
ctcaacacgttgaccatagcttcagagcaccatgggcagcctttgtggctcacccagacc
caagagtatgccaacaaagttctgctctgcctcttcactgtggagatgctcctcaaactg
tacggcctgggcccctctgtctacgttgcctcctttttcaaccgctttgactgcttcgtg
gtctgtgggggcatcctagaaaccactttggtggaggtgggggccatgcagcctcttggc
atctcagtgctccgatgtgtacgtctcctcaggatcttcaaggtcaccaggcactgggca
tccctgagcaatctggtggcatctttgctcaattccatgaagtccatcgcctccttgctg
cttctcctctttctcttcatcatcatcttctccctgcttggcatgcagctgtttgggggc
aagttcaactttgaccagacccacaccaagaggagcacctttgataccttcccccaagcc
ctcctcactgtctttcagatcctgactggtgaggattggaacgttgtcatgtatgatggt
atcatggcctacggtgggcccttcttcccagggatgctggtgtgtgtttatttcatcatc
ctcttcatctgtggcaactacatcctgctgaacgtgtttcttgccattgccgtggataac
ctagccagcggggatgcaggcactgccaaagacaagggcagagagaagagcagtgaagga
aaccctccaaaggagaacaaagtattggtgcctggtggagagaatgaggacgcaaagggt
gcaagaagtgaaggagcagcaccaggcatggaggaggaggaggaggaggaagaagaagaa
gaggaggaggaggaagaggaaaatggtgcaggacatgtggaactcttgcaggaagtagta
cccaaggagaaggtggtacccatccctgaaggcagtgccttcttctgccttagccaaacc
aacccgcttcggaaggcctgccacacactcatacatcaccatatcttcaccagtctcatc
ctagtgttcatcatcctcagtagtgtgtccctggctgctgaggaccccatccgagctcac
tccttccgaaaccatattctgggatattttgattatgccttcacctccatattcactgtg
gagattctactcaagatgacagtgtttggggccttcctgcaccgaggctctttctgccgt
agctggttcaatctgttggatctccttgtggtcagtgtgtccctcatctccttcggcatc
cactccagtgccatctcagttgtgaagattctccgagtcctccgagtcctgcggcctctc
cgagccatcaacagagccaagggactcaagcatgtggtgcagtgtgtgttcgtggccatc
cggaccatcggaaacatcatgattgtcaccaccctcttgcagttcatgttcgcctgcatt
ggtgttcagctgttcaagggaaaattctacagttgcactgatgaggccaaacacaccctg
aaagaatgcaagggctccttcctcatctaccctgatggagatgtgtcacgacctttggtc
cgggagcggctctgggtcaacagtgattttaactttgacaacgtcctttcagccatgatg
gccctgttcactgtctctacctttgaaggctggcctgcgctactatacaaggccatagat
gcaaacgcagaagatgagggccctatctacaattaccatgtggagatatcagtattcttc
attgtctacatcatcatcatcgccttcttcatgatgaacatctttgtgggctttgttatc
atcacattccgtgcccagggagagcaggagtaccaaaactgtgaactggacaagaaccag
cgccagtgtgtggaatatgccctcaaagctcagccactccgccgatacatccctaagaat
cctcatcagtaccgcgtgtgggccactgtgaactctgctgcctttgagtacctcatgttt
ctgctcatcctgctcaacacggtggccctagccatgcagcactatgaacagactgctccc
tttaactatgccatggacatcctcaacatggtcttcactggcctcttcaccattgagatg
gtgctcaaaatcatcgcctttaaacccaagcattactttgcagatgcctggaatacgttt
gatgctctcattgtagtgggcagtgtagtcgacatcgccgtcacagaagtcaataacgga
ggccatcttggcgagagttcagaggacagctcccgcatatctatcacgttctttcgcctc
ttccgagtcatgaggctggtcaagcttctgagtaagggtgaggggatccgcacactgctc
tggacattcatcaagtctttccaggccttgccctatgtggcacttctcatagcaatgata
ttcttcatctatgcagtcattggcatgcagatgtttggcaaggtggctcttcaggacggc
acgcagataaatcgaaacaacaatttccagacctttccgcaggctgtgctgcttctgttc
aggtgtgccactggtgaggcctggcaagagataatgctagccagccttccaggaaatcga
tgtgaccctgagtctgactttggcccaggcgaggaatttacctgtggtagcagttttgcc
atcgtctacttcatcagcttctttatgctctgtgccttcctgattataaatctctttgtg
gctgtaatcatggataactttgattacctaaccagagattggtctatcctgggaccccac
caccttgatgaattcaagaggatctggtctgaatatgaccccggagccaagggccgcatc
aagcacttggatgtggttgccctgctgagacgcatccagcccccattgggatttggaaag
ctatgcccacaccgagtggcctgcaagagactcgtggcaatgaatgtgcccctcaactca
gatggaacagtgacattcaacgctacactctttgccctggtgcggacatccctgaagatc
aagacagaagggaacctggatcaagccaaccaggagcttcggatggtcatcaaaaagatc
tggaagcggataaagcagaaattgttggatgaggtcatccctcctcccgatgaggaggag
gtcactgtgggaaaattctatgccacattcctgatccaagattatttccgaaaattccgg
agaaggaaagaaaaggggctactaggaagagaggccccaacaagcacatcctctgccctc
caggctggtctaaggagcctgcaggacttgggtcctgagatccgtcaagccctcacctat
gacactgaggaagaagaggaagaggaagaggcagtgggtcaggaggctgaggaagaggaa
gctgagaacaacccagaaccatacaaagactccatagactcccagccccaatctcgatgg
aactctaggatttcggtgtctctacctgttaaggagaaacttccagattctctctcaact
gggccgagtgatgatgatgggctggctcccaactccaggcagcccagtgtgatacaggct
ggctcccaaccacacaggagaagctctggggttttcatgttcactatcccggaagaagga
agtattcagctcaagggaactcaagggcaggacaatcagaatgaggaacaggaagtccct
gactggactcctgacctggatgagcaggccgggactccttcgaacccagtccttttacca
cctcactggtcccagcaacacgtaaacgggcaccatgtgccacgccgacgtttgctgccc
cccacgcctgcaggtcggaagccctccttcaccatccagtgtctgcaacgccagggcagt
tgtgaagatttacctatcccaggcacctaccatcgtggacggacctcaggaccaagcagg
gctcagggttcctgggcagcccctcctcagaagggtcgactgctatatgcccccctgttg
ttggtggaggaatctacagtgggtgaaggataccttggcaaacttggcggcccactgcgt
accttcacctgtctgcaagtgcctggagctcatccgaatcccagccaccgcaagaggggc
agtgctgacagtttggtggaggctgtgctcatctccgaaggcctaggtctctttgcccaa
gacccacgatttgtggccctggccaagcaggagattgcagatgcatgtcacctgaccctg
gatgagatggacagtgctgccagtgacctgctggcacagagaaccacctccctttacagt
gatgaggagtctattctttcccgctttgatgaagaggacctgggagatgagatggcctgt
gtccatgccctctaa

DBGET integrated database retrieval system