KEGG   Mus musculus (house mouse): 12291
Entry
12291             CDS       T01002                                 
Symbol
Cacna1g, Cav3.1d, [a]1G, a1G, alpha-1G, mKIAA1123
Name
(RefSeq) calcium channel, voltage-dependent, T type, alpha 1G subunit
  KO
K04854  voltage-dependent calcium channel T type alpha-1G
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04020  Calcium signaling pathway
mmu04713  Circadian entrainment
mmu04925  Aldosterone synthesis and secretion
mmu04927  Cortisol synthesis and secretion
mmu04929  GnRH secretion
mmu04930  Type II diabetes mellitus
mmu04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    12291 (Cacna1g)
   04020 Calcium signaling pathway
    12291 (Cacna1g)
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    12291 (Cacna1g)
   04925 Aldosterone synthesis and secretion
    12291 (Cacna1g)
   04927 Cortisol synthesis and secretion
    12291 (Cacna1g)
  09159 Environmental adaptation
   04713 Circadian entrainment
    12291 (Cacna1g)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    12291 (Cacna1g)
   04934 Cushing syndrome
    12291 (Cacna1g)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    12291 (Cacna1g)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   12291 (Cacna1g)
SSDB
Motif
Pfam: Ion_trans PKD_channel
Other DBs
NCBI-GeneID: 12291
NCBI-ProteinID: NP_001106284
MGI: 1201678
Ensembl: ENSMUSG00000020866
UniProt: E9PWL1 Q27YN9 Q9WUT2
Position
11:complement(94299217..94365226)
AA seq 2272 aa
MDEEEDGAGAEESGQPRSFTQLNDLSGAGGRQGPGSTEKDPGSADSEAEGLPYPALAPVV
FFYLSQDSRPRSWCLRTVCNPWFERVSMLVILLNCVTLGMFRPCEDIACDSQRCRILQAF
DDFIFAFFAVEMVVKMVALGIFGKKCYLGDTWNRLDFFIVIAGMLEYSLDLQNVSFSAVR
TVRVLRPLRAINRVPSMRILVTLLLDTLPMLGNVLLLCFFVFFIFGIVGVQLWAGLLRNR
CFLPENFSLPLSVDLEPYYQTENEDESPFICSQPRENGMRSCRSVPTLRGEGGGGPPCGL
DYEAYNSSSNTTCVNWNQYYTNCSAGEHNPFKGAINFDNIGYAWIAIFQVITLEGWVDIM
YFVMDAHSFYNFIYFILLIIVGSFFMINLCLVVIATQFSETKQRESQLMREQRVRFLSNA
STLASFSEPGSCYEELLKYLVYILRKAARRLAQVSRAVGVRAGLLSSPVARGGQEPQPSG
SCSRSHRRLSVHHLVHHHHHHHHHYHLGNGTLRVPRASPEIQDRDANGSRWLMLPPPSTP
TPSGGPPRGAESVHSFYHADCHLEPVRCQAPPPRSPSEASGRTVGSGKVYPTVHTSPPPE
MLKDKALVEVAPSPGPPTLTSFNIPPGPFSSMHKLLETQSTGACHSSCKISSPCSKADSG
ACGPDSCPYCARTGAGEPESADHEMPDSDSEAVYEFTQDAQHSDLRDPHRRRRPSLGPDA
EPSSVLAFWRLICDTFRKIVDSKYFGRGIMIAILVNTLSMGIEYHEQPEELTNALEISNI
VFTSLFALEMLLKLLVYGPFGYIKNPYNIFDGVIVVISVWEIVGQQGGGLSVLRTFRLMR
VLKLVRFLPALQRQLVVLMKTMDNVATFCMLLMLFIFIFSILGMHLFGCKFASERDGDTL
PDRKNFDSLLWAIVTVFQILTQEDWNKVLYNGMASTSSWAALYFIALMTFGNYVLFNLLV
AILVEGFQAEGDATKSESEPDFFSPSVDGDGDRKKRLALVALGEHSELRKSLLPPLIIHT
AATPMSLPKSSSTGVGEALGSGSRRTSSSGSAEPGTAHHEMKSPPSARSSPHSPWSAASS
WTSRRSSRNSLGRAPSLKRRSPSGERRSLLSGEGQESQDEEESSEEDRASPAGSDHRHRG
SLEREAKSSFDLPDTLQVPGLHRTASGRSSASEHQDCNGKSASGRLARTLRADDPPLDGD
DGDDEGNLSKGERLRAWVRARLPACCRERDSWSAYIFPPQSRFRLLCHRIITHKMFDHVV
LVIIFLNCITIAMERPKIDPHSAERIFLTLSNYIFTAVFLAEMTVKVVALGWCFGEQAYL
RSSWNVLDGLLVLISVIDILVSMVSDSGTKILGMLRVLRLLRTLRPLRVISRAQGLKLVV
ETLMSSLKPIGNIVVICCAFFIIFGILGVQLFKGKFFVCQGEDTRNITNKSDCAEASYRW
VRHKYNFDNLGQALMSLFVLASKDGWVDIMYDGLDAVGVDQQPIMNHNPWMLLYFISFLL
IVAFFVLNMFVGVVVENFHKCRQHQEEEEARRREEKRLKRLEKKRRSKEKQMADLMLDDV
IASGSSASAASEAQCKPYYSDYSRFRLLVHHLCTSHYLDLFITGVIGLNVVTMAMEHYQQ
PQILDEALKICNYIFTVIFVLESVFKLVAFGFRRFFQDRWNQLDLAIVLLSIMGITLEEI
EVNASLPINPTIIRIMRVLRIARVLKLLKMAVGMRALLDTVMQALPQVGNLGLLFMLLFF
IFAALGVELFGDLECDETHPCEGLGRHATFRNFGMAFLTLFRVSTGDNWNGIMKDTLRDC
DQESTCYNTVISPIYFVSFVLTAQFVLVNVVIAVLMKHLEESNKEAKEEAELEAELELEM
KTLSPQPHSPLGSPFLWPGVEGVNSPDSPKPGAPHTTAHIGAASSGFSLEHPTMVPHTEE
GPVPLGPDLLTVRKSGVSRTHSLPNDSYMCRNGSTAERSLGHRGWGLPKAQSGSILSVHS
QPADTSCILQLPKDAHYLLQPHGAPTWGAIPKLPPPGRSPLAQRPLRRQAAIRTDSLDVQ
GLGSREDLLSEVSGPSCPLTRSSSFWGGSSIQVQQRSGSQSKVSKHIRLPAPCPGLEPSW
AKDPQETRSSLELDTELSWISGDLLPSSQEEPLSPRDLKKCYSVEAQSCRRRPGSWLDEQ
RRHSIAVSCLDSGSQPRLCPSPSSLGGQPLGGPGSRPKKKLSPPSISIDPPESQGPRPPC
SPGVCLRRRAPASDSKDPSASSPLDSTAASPSPKKDALSLSGLSSDPTDLDP
NT seq 6819 nt   +upstreamnt  +downstreamnt
atggatgaggaagaggatggagcgggcgccgaggagtcgggacagccccggagcttcacg
cagctcaacgacctgtctggggccgggggccggcaggggccggggtcgacggaaaaggac
ccgggcagcgcggactccgaggcggaggggctgccctacccggcgctggccccggtggtt
ttcttctacttgagccaggacagccgcccgcggagctggtgtctccgcacggtctgtaac
ccgtggttcgagcgagtcagcatgctggttattctcctcaactgtgtgactctgggtatg
ttcaggccgtgtgaggacattgcctgtgactcccaacgctgccggatcctgcaggccttc
gacgacttcatctttgccttctttgctgtggaaatggtggtgaagatggtcgctttgggt
atctttgggaagaaatgttacctgggagacacttggaaccggcttgacttttttatcgtc
attgctgggatgctggagtactcgctggacctgcagaatgtcagcttctccgcagtcagg
acagtccgtgtgctgcgaccgctcagggccattaaccgggtgcccagcatgcgcattctc
gtcacattactgctggataccttgcctatgctgggcaatgtcctgctgctctgtttcttc
gtctttttcatctttggcatcgttggtgttcagctgtgggcagggctacttcgaaaccga
tgcttcctccctgagaatttcagcctcccgctgagtgtggacttggagccttactaccag
acagagaatgaggacgagagccccttcatctgctctcagcctcgggagaacggcatgcga
tcctgcaggagcgtgcccacactgcgcggggaaggcggtggtggtccaccctgcggtctg
gactatgaggcctataacagttccagcaataccacctgtgtcaactggaaccaatactat
accaactgctctgcaggcgagcacaaccccttcaaaggcgccatcaactttgacaacatt
ggctatgcctggatcgccatcttccaggtcatcacactggagggctgggtcgacatcatg
tactttgtgatggatgctcattccttctacaacttcatctacttcattcttctcatcatc
gtgggctccttcttcatgatcaacctgtgcctggtggtgatcgccacacagttctctgag
accaagcaacgggagagtcagctgatgcgggagcagcgtgtacgattcctgtccaatgct
agcaccctggcaagcttctctgagccaggcagctgctatgaggagcttctcaagtacctg
gtgtacatcctccgcaaagcagcccgcaggctggcccaggtctctagggctgtaggcgtg
cgggctgggttgctcagcagcccagtggcccgtggtgggcaggagccccagcccagtggc
agctgctctcgttcacaccgtcgtctgtctgtccaccacctggtccaccaccatcaccac
caccatcaccactaccacctgggtaatgggacgctcagagttccccgggccagcccagag
atccaggacagggatgccaatgggtcccgctggctcatgctgccaccaccctctaccccc
actccctctgggggccctccgaggggtgcggagtctgtacacagcttctaccatgctgac
tgccacttggagccagtccgttgccaggcgccccctcccaggtccccatcggaggcatct
ggcaggactgtgggtagtgggaaggtataccccactgtgcataccagccctccaccagag
atgctgaaggataaggcactagtggaggtggcccccagccctgggccccccaccctcacc
agcttcaacatcccacctgggcccttcagctccatgcacaagctcctggagacacagagt
acgggagcctgccatagctcctgcaaaatctccagcccttgctccaaggcagacagtgga
gcctgtgggccggacagttgtccctactgtgcccggacaggagcaggggagccagagtcc
gctgaccatgaaatgcctgactcagacagtgaggctgtgtatgagttcacacaggacgct
cagcacagcgacctccgggatccccacagacggcgacggccgagcctgggcccagatgca
gagcctagttctgtgctggccttctggaggctgatctgcgacacattccggaagatcgta
gatagcaaatactttggccggggaatcatgatcgctatcctggtcaataccctcagcatg
ggcatcgagtaccacgagcagcccgaggagctcaccaacgccctggaaatcagcaacatc
gtcttcaccagcctcttcgccttggagatgctgctgaagctgctcgtctacggtcccttc
ggctacattaagaatccctacaacatctttgatggcgtcattgtggtcatcagcgtgtgg
gagattgtgggccagcagggaggtggcctgtcggtgctgcggaccttccgcctgatgcgg
gtgctgaagctagttcgcttcctgccggcactgcagcggcagctcgtggtgctcatgaag
accatggacaacgtggccaccttctgcatgctgctcatgctcttcatcttcatcttcagc
atcctgggcatgcacctttttggttgcaagttcgcatctgaacgggatggggacacgttg
ccagaccggaagaattttgactccctgctctgggccattgtcactgtctttcagattctg
actcaggaagactggaataaagtcctttacaacggcatggcctccacgtcatcttgggct
gctctttacttcatcgccctcatgacttttggcaactacgtgctctttaacctgcttgtc
gccattctcgtggagggtttccaggcagagggagatgccaccaagtctgagtcagagcct
gatttcttttcgcccagtgtggatggtgatggggacaggaagaagcgcttggccctggtg
gccttgggagaacactcggaactacgaaagagccttttgccacctctcatcatccacaca
gctgctacaccgatgtcactgcccaagagctccagcacaggtgtgggggaagcactgggc
tctggctctcgccgcaccagtagcagtgggtccgctgagcctggaactgcccatcatgag
atgaaatcaccgccaagtgcccgaagctccccgcacagtccctggagcgcagcaagcagc
tggaccagcaggcgctccagccggaacagcctgggccgggcccccagcctgaagcgtagg
agcccaagcggggagcggaggtccctgctgtctggagagggtcaggagagccaggatgag
gaggagagttcagaagaggaccgggccagcccagcaggcagtgatcatcgccacaggggt
tccttggaacgtgaggccaagagttcctttgacctgcctgacaccctgcaggtgcccggg
cttcatcgaacagccagcggtcggagctctgcctctgaacaccaagactgtaatggcaag
tcggcttcagggcgtttggcccgcaccctgcgggctgatgaccccccactggatggggat
gatggcgatgatgagggcaacctgagcaaaggggaacgcttacgagcctgggtccgagcc
cggctccctgcctgttgccgagagcgagattcctggtctgcctatatcttccctccccag
tcaaggtttcgtctcctgtgtcaccggatcatcacccacaagatgtttgaccatgtggtc
ctcgtcatcatcttcctcaactgtatcaccatcgctatggagcgccccaaaattgacccc
cacagcgctgaacgcatcttcctgaccctctccaactacatcttcacggcagtcttcctg
gctgaaatgacagtgaaggtggtggcactgggctggtgctttggggagcaggcctacctg
cgcagcagctggaacgtgctggacggcttgctggtgctcatctctgtcatcgacatcctg
gtgtccatggtctctgacagcggcaccaagattctcggcatgctgagggtgctgcggctg
ctgcggaccctacgtccactcagggtcatcagccgggcccaggggctgaagctggtggta
gagactctgatgtcatccctcaaacccattggcaacattgtggtcatctgctgtgccttc
ttcatcatttttggaattcttggggtgcagctcttcaaagggaagttcttcgtgtgtcag
ggtgaggacaccaggaacatcactaacaagtccgactgtgctgaggccagttaccggtgg
gtccggcacaagtacaactttgacaacctgggccaggctctgatgtccctgtttgtgctg
gcctccaaggatggctgggttgacatcatgtatgatggactggatgctgtgggagtggac
cagcagcccatcatgaaccacaacccttggatgctgctctacttcatctccttcctcctc
atcgtggccttcttcgtcctgaacatgtttgtgggcgtggtggtggagaacttccataag
tgcaggcagcaccaggaggaggaggaggcgcggcggcgggaggagaagcgactaaagagg
ctggagaaaaagagaaggagtaaggagaagcagatggccgatctaatgttggacgatgta
attgcttccggcagctcagccagcgctgcgtcagaagcccagtgcaaaccctactactct
gactactcgcgcttccggctcctcgtccaccacctgtgtaccagccactacctggacctc
ttcatcactggtgtcatcgggctgaatgtggtcacgatggccatggaacattaccagcag
ccccagatcctggacgaggctctgaagatctgcaactacatctttaccgtcatctttgtc
ttggagtcagtattcaaacttgtggccttcggcttccgccggttcttccaggacaggtgg
aaccagctggacctggctattgtgcttctgtccatcatgggcatcacgctggaagagatt
gaggtcaatgcttcactgcccatcaaccccaccatcatccgtatcatgagggtgctccgc
attgctcgagttctgaagctgttgaagatggctgtgggcatgcgggcactgctggacacg
gtgatgcaggccctgccccaggtggggaacctgggacttctcttcatgctattatttttc
atctttgcagctctgggcgtggagctctttggagacctggagtgtgatgagacacaccct
tgtgagggcttgggccggcatgccacctttaggaactttggtatggcctttctgaccctc
ttccgagtctccactggtgacaactggaatggtattatgaaggacaccctccgggactgt
gaccaggagtccacctgctacaacaccgtcatctcacccatctacttcgtgtccttcgtg
ctgacggcccagtttgtgctggtcaacgtggtcatagccgtgctgatgaagcacctggaa
gagagcaacaaagaggccaaggaggaggcggagttggaggcggagctggagctagagatg
aagacactcagcccgcagccccactccccgctgggcagccccttcctctggcctggggtg
gaaggtgtcaatagccctgacagccctaagcctggggctccacacaccacggcccacatt
ggagcagcctcttcaggcttctcccttgagcaccccacgatggtacctcacactgaggag
gggccagtccccctaggaccagacctgctgactgtgaggaagtctggtgtcagccggaca
cactctctgcccaatgacagctacatgtgccgcaatgggagcactgccgagagatcccta
ggacacaggggctgggggctccccaaagcccagtcaggctccatcttgtctgttcactcc
caaccagcagacaccagctgcatcctacagcttcccaaagatgcacactatctgctccag
cctcatggggctcccacctggggcgccatccctaaactacccccacctggccgctcccct
ctggctcagaggcctctcaggcgccaggcagcaataaggactgactccctggacgtgcag
ggcctgggtagccgggaagacctgttgtcagaggtgagtgggccctcctgccctctgacc
cgctcctcatccttctggggcgggtcgagcatccaggtgcagcagcgctccggcagccag
agcaaagtctccaagcacatccgcctgccagccccttgcccaggcctggaacccagctgg
gccaaggaccctcaagagaccagaagcagcttagagctggacacggagctgagctggatt
tcaggagacctcctgcccagcagtcaggaagaacccctgtccccacgggacttgaaaaaa
tgctacagtgtagaggcccagagctgccggcgcaggcctgggtcctggctagacgaacag
aggagacactccatcgctgtcagctgcctggacagcggctcccagccccgcctatgtcca
agcccctcaagcctcgggggccaacctcttgggggccctgggagccggcctaagaaaaaa
ctcagcccacccagtatctctatagaccccccggagagccagggccctcggcccccatgc
agtcctggcgtctgcctcaggaggagggcgccggccagtgactcgaaggatccctcggcc
tccagcccccttgacagcacggctgcctcaccctccccaaagaaagatgcgctgagtctc
tctggtttgtcttctgacccaacagacctggatccctga

DBGET integrated database retrieval system