KEGG   Mus musculus (mouse): 12292Help
Entry
12292             CDS       T01002                                 

Gene name
Cacna1s, AW493108, Cav1.1, Cchl1a3, DHPR, DHPR_alpha1s, fmd, mdg, sj
Definition
(RefSeq) calcium channel, voltage-dependent, L type, alpha 1S subunit
  KO
K04857  voltage-dependent calcium channel L type alpha-1S
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04020  Calcium signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04024  cAMP signaling pathway
mmu04260  Cardiac muscle contraction
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04270  Vascular smooth muscle contraction
mmu04723  Retrograde endocannabinoid signaling
mmu04725  Cholinergic synapse
mmu04726  Serotonergic synapse
mmu04727  GABAergic synapse
mmu04911  Insulin secretion
mmu04912  GnRH signaling pathway
mmu04921  Oxytocin signaling pathway
mmu04924  Renin secretion
mmu04925  Aldosterone synthesis and secretion
mmu04927  Cortisol synthesis and secretion
mmu04929  GnRH secretion
mmu04934  Cushing syndrome
mmu04935  Growth hormone synthesis, secretion and action
mmu05010  Alzheimer disease
mmu05410  Hypertrophic cardiomyopathy (HCM)
mmu05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
mmu05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    12292 (Cacna1s)
   04020 Calcium signaling pathway
    12292 (Cacna1s)
   04024 cAMP signaling pathway
    12292 (Cacna1s)
   04022 cGMP-PKG signaling pathway
    12292 (Cacna1s)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    12292 (Cacna1s)
   04929 GnRH secretion
    12292 (Cacna1s)
   04912 GnRH signaling pathway
    12292 (Cacna1s)
   04921 Oxytocin signaling pathway
    12292 (Cacna1s)
   04935 Growth hormone synthesis, secretion and action
    12292 (Cacna1s)
   04924 Renin secretion
    12292 (Cacna1s)
   04925 Aldosterone synthesis and secretion
    12292 (Cacna1s)
   04927 Cortisol synthesis and secretion
    12292 (Cacna1s)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    12292 (Cacna1s)
   04261 Adrenergic signaling in cardiomyocytes
    12292 (Cacna1s)
   04270 Vascular smooth muscle contraction
    12292 (Cacna1s)
  09156 Nervous system
   04727 GABAergic synapse
    12292 (Cacna1s)
   04725 Cholinergic synapse
    12292 (Cacna1s)
   04726 Serotonergic synapse
    12292 (Cacna1s)
   04723 Retrograde endocannabinoid signaling
    12292 (Cacna1s)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    12292 (Cacna1s)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    12292 (Cacna1s)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    12292 (Cacna1s)
   05414 Dilated cardiomyopathy (DCM)
    12292 (Cacna1s)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    12292 (Cacna1s)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    12292 (Cacna1s)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   12292 (Cacna1s)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel CAC1F_C
Motif
Other DBs
NCBI-GeneID: 12292
NCBI-ProteinID: NP_001074492
MGI: 88294
Ensembl: ENSMUSG00000026407
Vega: OTTMUSG00000033761
UniProt: F8VQE0
Position
1 E4; 1 59.55 cM
AA seq 1852 aa AA seqDB search
MEPPSPQDEGLRKKQPKKPVPEILPRPPRALFCLTLQNPLRKACISIVEWKPFETIILLT
IFANCVALAVYLPMPEDDNNTLNLGLEKLEYFFLIVFSIEAAMKIIAYGFLFHQDAYLRS
GWNVLDFIIVFLGVFTVILEQVNIIQTNTAPMSSKGAGLDVKALRAFRVLRPLRLVSGVP
SLQVVLNSIFKAMLPLFHIALLVLFMVIIYAIIGLELFKGKMHKTCYFIGTDIVATVENE
KPSPCARTGSGRPCTINGSECRGGWPGPNHGITHFDNFGFSMLTVYQCISMEGWTDVLYW
VNDAIGNEWPWIYFVTLILLGSFFILNLVLGVLSGEFTKEREKAKSRGTFQKLREKQQLE
EDLRGYMSWITQGEVMDVDDLREGKLSLDEGGSDTESLYEIEGLNKIIQFIRHWRQWNRV
FRWKCHDLVKSKVFYWLVILIVALNTLSIASEHHNQPLWLTHLQDVANRVLLTLFTIEML
MKMYGLGLRQYFMSIFNRFDCFVVCSGILEILLVESGAMSPLGISVLRCIRLLRLFKITK
YWTSLSNLVASLLNSIRSIASLLLLLFLFIIIFALLGMQLFGGRYDFEDTEVRRSNFDNF
PQALISVFQVLTGEDWNSVMYNGIMAYGGPTYPGVLVCIYFIILFVCGNYILLNVFLAIA
VDNLAEAESLTSAQKAKAEERKRRKMSKGLPDKSEEERATVTKKLEQKSKGEGIPTTAKL
KIDEFESNVNEVKDPYPSADFPGDDEEDEPEIPVSPRPRPLAELQLKEKAVPIPEASSFF
IFSPTNKIRVLCHRIVNATWFTNFILLFILLSSAALAAEDPIRADSMRNQILEYFDYVFT
AVFTVEIVLKMTTYGAFLHKGSFCRNYFNILDLLVVAVSLISMGLESSAISVVKILRVLR
VLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVLVTTLLQFMFACIGVQLFKGKFYSCNDL
SKMTEEECRGYYYIYKDGDPTQIELRPRQWIHNDFHFDNVLSAMMSLFTVSTFEGWPQLL
YKAIDSNEEDTGPVYNNRVEMAIFFIIYIILIAFFMMNIFVGFVIVTFQEQGETEYKNCE
LDKNQRQCVQYALKARPLRCYIPKNPYQYQVWYVVTSSYFEYLMFALIMLNTICLGMQHY
NQSEQMNHISDILNVAFTIIFTLEMVLKLIAFKPRGYFGDPWNVFDFLIVIGSIIDVILS
EIDTFLASSGGLYCLGGGCGNVDPDESARISSAFFRLFRVMRLVKLLNRAEGVRTLLWTF
IKSFQALPYVALLIVMLFFIYAVIGMQMFGKIAMVDGTQINRNNNFQTFPQAVLLLFRCA
TGEAWQEILLACSYGKLCDPESDYAPGEEHTCGTNFAYYYFISFYMLCAFLIINLFVAVI
MDNFDYLTRDWSILGPHHLDEFKAIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKFCP
HRVACKRLVGMNMPLNSDGTVTFNATLFALVRTALKIKTEGNFEQANEELRAIIKKIWKR
TSMKLLDQVIPPIGDDEVTVGKFYATFLIQEHFRKFMKRQEEYYGYRPKKDTVQIQAGLR
TIEEEAAPEIHRAISGDLTAEEELERAMVEAAMEEGIFRRTGGLFGQVDNFLERTNSLPP
VMANQRPLQFAEIEMEELESPVFLEDFPQNPGTHPLARANTNNANANVAYGNSSHRNNPV
FSSICYEREFLGEADMPVTREGPLSQPCRASGPHSRSHVDKLKRPMTQRGMPEGQVPPSP
CQVTGAKAEHPVQKEGKGPTSRFLETPNSRNFEEHVPRNSAHRCTAPATAMLIQEALVRG
GLDSLAADANFVMATGQALADACQMEPEEVEVAATELLKQESPEGGAVPWEP
NT seq 5559 nt NT seq  +upstreamnt  +downstreamnt
atggagccgccctcaccccaggacgagggcctgaggaagaagcagccgaagaaacctgtt
cctgagattctgccgaggcccccgcgggccttgttctgcctgactctacagaaccccctg
aggaaggcctgcatcagcatcgtggaatggaaacccttcgagaccatcatcttgctcacc
atctttgccaactgtgtggccctggcagtgtacctgcccatgccagaggatgacaacaac
actctgaacctcggcctggagaaactggagtacttcttcctcattgtcttctccattgaa
gccgccatgaagatcatagcctacggcttcctattccatcaggatgcatacctgcgcagt
ggctggaacgttctggacttcatcattgtctttctgggggtcttcactgtgattctggaa
caagttaacatcattcaaaccaacacggcccccatgagcagcaaaggagccggcttggat
gtgaaggcccttcgagcattccgcgtgctcagacccctgcggctggtgtcgggggtgccc
agtcttcaggtggtcctcaactccatcttcaaggccatgctccccctgttccacattgcc
ctgctcgtcctcttcatggtcatcatctacgccatcattgggctggagctcttcaaaggc
aagatgcacaagacttgctacttcattgggacagacattgtagccacagttgagaatgag
aaaccatcaccctgtgctagaactggctctgggcgtccctgcaccatcaatggcagcgag
tgccgaggaggttggccaggacccaaccacggcatcacccacttcgacaactttggcttc
tctatgctcactgtgtatcaatgcatctccatggaggggtggactgatgtcctgtactgg
gtcaacgatgccatcgggaatgagtggccctggatctactttgtcaccctcattctgctg
ggctccttcttcatcctcaacctggtgctgggtgtcctgagtggagaattcaccaaagag
cgagagaaggccaagtccaggggaaccttccaaaagctccgagagaaacagcagctggag
gaggacctccgtggttacatgagctggatcacacagggcgaggtcatggacgtggacgac
ttgagagaaggcaagctgtctttggatgaagggggatcagacacagagagcttgtatgaa
atcgaaggcttgaacaaaatcatccagttcattcggcactggcgacagtggaatcgcgtc
ttccgctggaagtgccatgacctagtgaaatccaaggtcttctattggctggtgatcctg
atcgttgccctaaacaccctgtccattgcctcggagcaccacaaccagccactctggttg
acccatttgcaagatgttgccaaccgcgtgttgctgaccctcttcaccatcgaaatgctc
atgaagatgtacgggctgggcctgcgccagtacttcatgtccatcttcaaccgcttcgac
tgcttcgtggtgtgcagcggcatcctggagatcctgctggtggagtcgggagccatgtcg
cccctgggcatctctgtgctccgctgtatccgcctcctgaggctcttcaagatcaccaag
tactggacatcgctgagcaacctggtggcctcactgctcaactccatccgctccattgct
tccctcttgctgctgctctttctcttcatcatcatctttgccctgctgggcatgcagctc
tttggaggcagatatgactttgaagacacagaagtacgacgaagcaactttgacaacttc
ccccaggccctcatcagtgtcttccaggtcctgacgggtgaagactggaactctgtgatg
tacaatgggatcatggcttacggaggtccgacctaccctggtgtgctggtgtgcatttat
ttcatcatccttttcgtctgtggcaactacatccttctcaacgtcttcctggctattgct
gtggacaacctggcagaggcagagagtctgacatctgcccaaaaggccaaggctgaggag
agaaagcgcaggaagatgtcgaaagggctcccagacaagtcagaagaggagagggccacg
gtgaccaagaaactggagcagaagtccaagggtgaaggcatccccaccaccgccaagctg
aaaatcgatgagtttgaatcaaacgttaatgaggtgaaagacccctacccttcggctgac
ttcccaggggacgatgaggaagatgagcccgagatcccagtgagcccccgaccacgccct
ctggccgagctgcagctgaaagagaaagcagtgcccatcccggaggctagctccttcttc
atcttcagtcccaccaacaagatccgtgtcctgtgtcaccgcattgtcaatgccacctgg
ttcaccaacttcatcctgctcttcatcctgctcagcagtgccgccctggccgctgaggat
cccatccgggccgactccatgaggaatcagatcctcgagtattttgattatgtgttcact
gctgttttcacggtggagattgtccttaagatgaccacctatggagccttcctgcacaaa
ggctccttctgccgcaactacttcaacatcctggacctgctggtggtggctgtgtccctc
atctccatgggcctcgagtccagcgccatctccgtggtgaagatcttaagggttctgaga
gtgctgagaccactccgggccataaacagagccaaagggttgaagcacgtggtgcagtgc
gtgtttgttgccattcgcaccatcgggaacatcgtgctggtcaccacgctcctgcagttc
atgtttgcgtgcattggagtgcagcttttcaagggaaagttctacagctgcaatgactta
tccaagatgactgaagaggaatgcaggggctactactacatatacaaggatggagacccc
actcagatagagctgcgtccccgccagtggatacacaatgacttccactttgacaatgta
ctctccgctatgatgtcactcttcacggtctccaccttcgagggttggcctcagctactg
tacaaggccatagactcaaatgaggaggacaccggccctgtctacaacaaccgagtggag
atggccatcttcttcattatctacatcatcctcattgccttcttcatgatgaacatcttt
gtgggctttgtcatcgttaccttccaggaacagggagagactgagtataagaactgtgag
ctcgacaagaaccagcgccaatgcgtacagtatgccctgaaggcccgcccactgaggtgt
tacatccccaaaaacccataccagtatcaggtgtggtatgtcgtcacttcctcctacttt
gaatacctgatgtttgctctcatcatgctcaatactatctgcctgggcatgcagcattac
aaccagtcggaacagatgaaccacatctcagacattctcaacgtggctttcaccatcatc
ttcaccctggagatggtcctcaagctcatagctttcaagcccaggggctattttggagat
ccttggaatgtgtttgacttcctaatcgtcatcggcagcatcattgacgtcatcctgagc
gagatcgatactttcctggcctccagcgggggactgtattgcctgggtggaggctgcggg
aacgttgacccagatgagagcgcccgtatctccagtgccttcttccgcctgttccgggtc
atgagactggtcaagctgctgaaccgggcggagggtgtgcgcaccctgctgtggacattc
atcaagtccttccaggccctgccgtacgtggctttgctgatcgtgatgctcttcttcatc
tacgcggtcatcggcatgcagatgttcgggaagatcgccatggtggacgggacgcagata
aaccggaacaacaacttccagactttcccacaggccgtgctgctgctcttcaggtgtgcc
acaggggaagcctggcaagagatcctgctggcctgcagctatgggaagctgtgtgacccg
gagtctgactacgcacccggggaggagcatacatgcggcaccaacttcgcctactactac
ttcatcagtttctacatgctctgcgccttcctgatcatcaacctctttgtggctgtcatc
atggacaactttgattacctcacaagggactggtccattctgggccctcaccacctggac
gagttcaaggccatttgggctgagtacgacccggaggctaagggcaggatcaagcacctg
gatgtggtgaccctgctgaggaggattcagccccctctgggctttgggaagttctgccca
cacagggtagcatgtaagaggctggtgggcatgaacatgcccctgaacagcgatggcaca
gtcacctttaatgccacactatttgccctggtgcgcacagccctcaagatcaagacagaa
ggcaactttgaacaagctaacgaggagctgagagccatcatcaagaagatctggaagaga
accagcatgaagctcttggaccaagtcatccctccaataggagatgatgaggtgacagta
gggaaattctatgccacattcctcatccaggagcacttccggaagttcatgaagcgccag
gaggaatattatgggtatcgacccaaaaaggacacagttcagatacaggctggattacgg
accatagaggaagaggcagctcctgagatccaccgtgccatctctggagacctgacagca
gaggaggaactggagagggccatggtagaggctgccatggaggaggggatattccggagg
acgggaggcctgtttggtcaagtggacaacttcctggaaaggaccaactctctgccccct
gtcatggccaaccaaagacccctccaatttgctgaaatagagatggaagagctggagtca
ccagtcttcttggaggacttccctcagaacccaggcacccaccctcttgctcgtgccaat
accaacaacgccaatgccaatgttgcctatggcaacagcagccatagaaacaacccagtg
ttttccagcatctgctatgaacgggagttcttgggagaggcggacatgcctgttaccaga
gaaggacccctcagtcagccctgcagggcctcaggacctcacagcagatctcatgtggac
aaactgaaaagaccgatgacccagagaggaatgcctgaaggccaggtgcctccttccccg
tgccaggtaacaggggcaaaagcagagcatcctgtgcagaaagagggaaagggccccacg
tcacggtttctggaaacacccaacagcaggaactttgaggagcacgttcccaggaattcg
gctcacaggtgcacggctccagctactgccatgctgatccaggaggctctggttcgagga
ggactagactccttagcagcagatgctaacttcgtcatggcaacaggccaggccctggca
gatgcctgccagatggaaccagaggaagtcgaggtggcagcaacagagctactgaagcaa
gaatccccagagggcggggccgtgccctgggagccttga

DBGET integrated database retrieval system