KEGG   Mus musculus (house mouse): 12293
Entry
12293             CDS       T01002                                 
Symbol
Cacna2d1, Ca(v)alpha2delta1, Cacna2, Cchl2a
Name
(RefSeq) calcium channel, voltage-dependent, alpha2/delta subunit 1
  KO
K04858  voltage-dependent calcium channel alpha-2/delta-1
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04260  Cardiac muscle contraction
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04921  Oxytocin signaling pathway
mmu05410  Hypertrophic cardiomyopathy
mmu05412  Arrhythmogenic right ventricular cardiomyopathy
mmu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    12293 (Cacna2d1)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    12293 (Cacna2d1)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    12293 (Cacna2d1)
   04261 Adrenergic signaling in cardiomyocytes
    12293 (Cacna2d1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    12293 (Cacna2d1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    12293 (Cacna2d1)
   05414 Dilated cardiomyopathy
    12293 (Cacna2d1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    12293 (Cacna2d1)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   12293 (Cacna2d1)
SSDB
Motif
Pfam: VGCC_alpha2 VWA_N VWA_3 VWA VWA_2 dCache_1 IFN-gamma
Other DBs
NCBI-GeneID: 12293
NCBI-ProteinID: NP_001104313
MGI: 88295
Ensembl: ENSMUSG00000040118
UniProt: O08532 Q14BH8
Position
5:16139390..16579509
AA seq 1103 aa
MAAGCLLALTLTLFQSGLIGPSSEEPFPSPVTIKSWVDKMQEDLVTLAKTASGVTQLADI
YEKYQDLYTVEPNNARQLVEIAARDIEKLLSNRSKALVRLAMEAEKVQAAHQWREDFASN
EVVYYNAKDDLDPERNESEPGSQRIKPVFIEDANFGRQISYQHAAVHIPTDIYEGSTIVL
NELNWTSALDEVFKRNRDEDPTLLWQVFGSATGLARYYPASPWVDNSRTPNKIDLYDVRR
RPWYIQGAASPKDMLILVDVSGSVSGLTLKLIRTSVSEMLETLSDDDFVNVASFNSNAQD
VSCFQHLVQANVRNKKVLKDAVNNITAKGITDYKKGFSFAFEQLLNYNVSRANCNKIIML
FTDGGEERAQEIFAKYNKDKKVRVFTFSVGQHNYDRGPIQWMACENKGYYYEIPSIGAIR
INTQEYLDVLGRPMVLAGDKAKQVQWTNVYLDALELGLVITGTLPVFNVTGQSENKTNLK
NQLILGVMGVDVSLEDIKRLTPRFTLCPNGYYFAIDPNGYVLLHPNLQPKPIGVGIPTIN
LRKRRPNVQNPKSQEPVTLDFLDAELENEIKVEIRNKMIDGESGEKTFRTLVKSQDERYI
DKGNRTYTWTPVNGTDYSLALVLPTYSFYYIKAKLEETITQARYSETLKPDNFEESGYTF
IAPREYCNDLKPSDNNTEFLLNFNEFIDRKTPNNPSCNTDLINRILLDAGFTNELVQNYW
SKQKNIKGVKARFVVTDGGITRVYPKEAGENWQENPETYEDSFYKRSLDNDNYVFTAPYF
NKSGPGAYESGIMVSKAVELYIQGKLLKPAVVGIKIDVNSWIENFTKTSIRDPCAGPVCD
CKRNSDVMDCVILDDGGFLLMANHDDYTNQIGRFFGEIDPSMMRHLVNISLYAFNKSYDY
QSVCDPGAAPKQGAGHRSAYVPSIADILQIGWWATAAAWSILQQLLLSLTFPRLLEAVEM
EEDDFTASLSKQSCITEQTQYFFKNDTKSFSGLLDCGNCSRIFHVEKLMNTNLVFIMVES
KGTCPCDTRLLMQAEQTSDGPDPCDMVKQPRYRKGPDVCFDNNVLEDYTDCGGVSGLNPS
LWSIFGLQFILLWLVSGSRHYLL
NT seq 3312 nt   +upstreamnt  +downstreamnt
atggctgctggctgcctgctggccttgactctgacacttttccaatctgggctgatcggc
ccctcgagcgaggagcccttcccttcgcccgtcactatcaagtcatgggtggacaagatg
caagaagaccttgtcacactggcaaaaacagcaagtggagtgactcagcttgctgatatt
tatgaaaaataccaagatttgtatactgtggagcccaacaatgcacgccaactggttgaa
attgcagcccgagacattgagaagcttctaagcaacagatctaaggccctggtgcgcctg
gctatggaagcagagaaagtccaagcagcccaccaatggagggaagattttgcaagcaat
gaagttgtctactataatgctaaggatgatcttgatcctgaaagaaatgagagtgagcca
ggcagccaacggattaaacctgtttttattgaagatgctaattttggacgtcagatatcc
tatcagcatgcagcggtccatattcccacggacatctatgagggctcaaccatagtgtta
aacgaactcaactggacaagtgccttagatgaagtattcaaaagaaatcgagacgaagac
cctacactgctgtggcaagtgtttggcagcgccactggcctggcccgatattatccagct
tctccatgggtggataatagtagaactccaaacaagattgatctatatgatgtacgcaga
agaccatggtacatccagggagctgcatcccccaaggacatgctcattctggtggacgtg
agtggaagtgtgagcggattgactctgaaactcatccgaacatctgtctccgagatgtta
gaaaccctctctgatgatgatttcgtgaatgtagcttcatttaacagcaacgctcaggat
gtaagctgtttccagcacctggttcaagcgaatgtaagaaataagaaggtgttgaaagat
gccgtgaataacattacagcaaaggggatcacagattacaagaaaggctttagctttgcc
ttcgaacagctacttaattataatgtttccagagctaattgcaataagattatcatgtta
ttcacggatggaggagaagagagagcccaggagatatttgccaaatacaataaagacaaa
aaagtccgtgtgtttacattttccgtcggtcaacataattatgacagaggacctattcag
tggatggcttgtgaaaataaaggttactattatgagattccctccattggtgcaataaga
atcaatactcaggaatatctagatgttctgggaagaccaatggttttagctggtgacaaa
gcgaagcaagttcaatggacaaatgtgtatttggacgccctggaactgggacttgtcatt
actggaactctaccagtcttcaacgtcactggccaatctgaaaataagacaaacttgaag
aaccagttgattcttggtgtgatgggcgttgatgtgtctctggaagatatcaagagattg
acaccacgttttacactctgtcccaatggctactattttgcaattgatcctaatggctat
gtcttattgcatccaaatcttcagccaaagcctattggtgtaggtataccgacaattaat
ttaaggaaaaggagacccaacgttcagaaccccaaatctcaggagccagtcacactggat
tttctcgatgctgagttagagaatgaaattaaagtggagattcgaaataaaatgatagat
ggagaaagtggagaaaaaacgttcagaactctggtcaagtctcaagatgagagatacatt
gacaaaggaaatcgaacatacacatggacgcctgtcaatggcacagattacagtttggcc
ttggtattgccaacctacagtttttactatataaaagccaaactagaagagacaataact
caggccagatattcagaaaccctgaagccagacaattttgaagaatctggctatactttc
atagcaccaagggaatactgcaatgatcttaaaccttcagataataacactgaatttctt
ttgaatttcaatgaatttattgataggaaaactccaaacaacccctcctgtaatacagat
ttgattaatagaatcttgctggatgcaggttttacaaatgaacttgtccaaaattattgg
agtaagcagaaaaatatcaaaggagtgaaggcacgctttgtggtgacagacggtgggatt
acgagagtttatcccaaagaggccggagaaaattggcaagagaacccagagacgtacgag
gacagcttctacaaacggagcctagataacgataactacgttttcactgcgccctacttt
aacaaaagtggacctggtgcgtatgaatctggaattatggtaagcaaagcagtagaactg
tatatccaaggaaaacttcttaagcccgcagttgtgggaattaaaattgatgtaaattct
tggatagaaaattttaccaaaacttcaatcagggatccgtgtgctggtccagtttgtgac
tgcaaaagaaacagtgatgtaatggactgtgtcattctagatgatggtggatttcttttg
atggcaaatcacgatgattacactaatcagattggacgtttttttggagagattgaccca
agcatgatgagacacctggttaatatatcactttatgcattcaacaaatcatatgactat
cagtccgtgtgcgatccaggggcagcaccaaagcagggggcaggacatcgctcagcatat
gtgccatcgattgcagatatactgcagattggctggtgggccaccgctgccgcctggtct
attctccagcagctgctcttgagtttgacatttccacggctccttgaggcagttgagatg
gaggaagatgacttcacagcctccctgtctaagcagagctgcatcacagaacaaacccag
tacttcttcaagaacgatactaaatcattcagtggtttactggactgtggaaactgttcc
aggatctttcatgtagagaaacttatgaacaccaacttagtattcataatggtggagagc
aaagggacatgtccgtgtgacacgcggctgctcatgcaagcggaacagacttctgatggt
ccagatccttgcgacatggtcaagcagcccagataccgaaaaggacctgatgtctgcttt
gataataatgtgctggaggattatactgactgtggtggtgtttctgggttaaacccttcc
ttatggtctatctttggactccagtttatactcctttggctggtatctggcagcagacac
tacctactgtga

DBGET integrated database retrieval system