KEGG   Mus musculus (house mouse): 12295
Entry
12295             CDS       T01002                                 
Symbol
Cacnb1, CAB1, Cchb1, Cchlb1
Name
(RefSeq) calcium channel, voltage-dependent, beta 1 subunit
  KO
K04862  voltage-dependent calcium channel beta-1
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04260  Cardiac muscle contraction
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04921  Oxytocin signaling pathway
mmu05410  Hypertrophic cardiomyopathy
mmu05412  Arrhythmogenic right ventricular cardiomyopathy
mmu05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    12295 (Cacnb1)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    12295 (Cacnb1)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    12295 (Cacnb1)
   04261 Adrenergic signaling in cardiomyocytes
    12295 (Cacnb1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    12295 (Cacnb1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    12295 (Cacnb1)
   05414 Dilated cardiomyopathy
    12295 (Cacnb1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    12295 (Cacnb1)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   12295 (Cacnb1)
SSDB
Motif
Pfam: Guanylate_kin VGCC_beta4Aa_N SH3_1 SH3_2
Other DBs
NCBI-GeneID: 12295
NCBI-ProteinID: NP_112450
MGI: 102522
Ensembl: ENSMUSG00000020882
Vega: OTTMUSG00000002912
UniProt: Q8R3Z5 A2A545
Structure
Position
11:complement(97892334..97913860)
AA seq 524 aa
MVQKSGMSRGPYPPSQEIPMEVFDPSPQGKYSKRKGRFKRSDGSTSSDTTSNSFVRQGSA
ESYTSRPSDSDVSLEEDREALRKEAERQALAQLEKAKTKPVAFAVRTNVGYNPSPGDEVP
VQGVAITFEPKDFLHIKEKYNNDWWIGRLVKEGCEVGFIPSPVKLDSLRLLQEQTLRQNR
LSSSKSGDNSSSSLGDVVTGTRRPTPPASGNEMTNFAFELDPLELEEEEAELGEHGGSAK
TSVSSVTTPPPHGKRIPFFKKTEHVPPYDVVPSMRPIILVGPSLKGYEVTDMMQKALFDF
LKHRFDGRISITRVTADISLAKRSVLNNPSKHIIIERSNTRSSLAEVQSEIERIFELART
LQLVALDADTINHPAQLSKTSLAPIIVYIKITSPKVLQRLIKSRGKSQSKHLNVQIAASE
KLAQCPPEMFDIILDENQLEDACEHLAEYLEAYWKATHPPSSTPPNPLLNRTMATAALAA
SPAPVSNLQVQVLTSLRRNLSFWGGLEASPRGGDAVAQPQEHAM
NT seq 1575 nt   +upstreamnt  +downstreamnt
atggtccagaagagcggcatgtcccggggcccttacccaccttcccaagagatccctatg
gaggtcttcgaccccagcccacagggcaagtacagcaagaggaaagggcggttcaaaagg
tcagacgggagtacgtcctcggatacaacatccaacagcttcgtccgccagggctcagca
gagtcctacacgagccgaccatcagactctgatgtgtctctggaggaggaccgggaagcc
ttaaggaaggaggcagagcgccaggccttagcccagctcgagaaagccaagaccaaacca
gtggcttttgctgttcggacaaatgttggctacaatccgtctccaggggatgaggtgcct
gtacagggagtggccatcacctttgagcccaaggacttcctacacatcaaggagaagtac
aataatgactggtggattgggcggctggtgaaggaaggctgcgaggttggcttcatcccc
agcccggtcaaactggacagccttcgtctgctgcaggaacagaccctgcgccagaaccgc
ctcagctccagcaagtcaggtgacaactccagttccagtctgggagatgtggtgactggc
acccgccgccccacaccccctgccagtggtaatgaaatgactaactttgcctttgagcta
gaccccctagagttagaggaggaggaggcagagctaggggagcacggcggctcagccaag
actagcgtgagcagtgtcaccacgccgccaccccacggcaagcgcatccccttctttaag
aagacagagcacgtgcccccctatgacgtggtgccttccatgaggcccatcatcctggtg
ggaccgtcgctcaagggctatgaggtgacagacatgatgcagaaagcgttgtttgacttc
ctcaagcatcggtttgatggcaggatttccatcacccgggtaacagctgacatttccctg
gccaaacgctccgtcctcaacaaccccagcaaacacatcatcattgagcgctccaacacg
cgttccagcctggctgaggtacagagtgaaattgagaggatcttcgagctggcccggacc
ttgcagctggtcgccttggacgctgacaccatcaaccacccagcccagctctctaaaacg
tcgctggcccccatcattgtttacatcaagatcacatctcccaaggtactgcagaggctc
atcaaatcccgagggaagtctcaatccaaacacctcaatgtccaaatagcagcctcggag
aagctggcacagtgtccccccgaaatgtttgacataatcctggacgagaaccaattggaa
gatgcctgcgagcacctggctgagtacttggaagcctactggaaggccacacatccgcct
agcagcacgccacccaatccgctgctgaaccgcaccatggctaccgcagctctggctgcc
agccctgcccccgtctccaacctccaggtacaggtgctcacctcgctcaggagaaatctc
agcttctggggcgggctggaggcctcaccgcggggaggcgacgcggtggcccagcctcag
gagcacgccatgtag

DBGET integrated database retrieval system