KEGG   Mus musculus (house mouse): 12301
Entry
12301             CDS       T01002                                 
Symbol
Cacybp, SIP
Name
(RefSeq) calcyclin binding protein
  KO
K04507  calcyclin binding protein
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    12301 (Cacybp)
SSDB
Motif
Pfam: Siah-Interact_N CS SGS DUF3090
Other DBs
NCBI-GeneID: 12301
NCBI-ProteinID: NP_033916
MGI: 1270839
Ensembl: ENSMUSG00000014226
UniProt: Q9CXW3
Structure
Position
1:complement(160029937..160040462)
AA seq 229 aa
MASVLEELQKDLEEVKVLLEKSTRKRLRDTLTSEKSKIETELKNKMQQKSQKKPELDNEK
PAAVVAPLTTGYTVKISNYGWDQSDKFVKIYITLTGVHQVPTENVQVHFTERSFDLLVKN
LNGKNYSMIVNNLLKPISVESSSKKVKTDTVIILCRKKAENTRWDYLTQVEKECKEKEKP
SYDTEADPSEGLMNVLKKIYEDGDDDMKRTINKAWVESREKQAREDTEF
NT seq 690 nt   +upstreamnt  +downstreamnt
atggcttccgttttggaagagttgcagaaagacctagaagaggtcaaagtattgctggaa
aagtccactaggaaaagactacgtgatactcttacaagtgaaaagtccaagattgagacg
gaactcaagaacaagatgcaacagaagtcgcagaagaaaccagaacttgataatgaaaag
ccagctgctgtggttgctcctcttacaacaggatacaccgtgaaaatcagtaattatgga
tgggatcagtcagataagtttgtgaaaatctacattaccttgactggcgtccatcaggtg
cccactgagaacgtgcaggtgcacttcacagagaggtcatttgatcttctggtaaaaaac
ctcaatggcaagaattactccatgattgtgaacaatcttttgaaacctatctctgtggaa
agcagttcaaaaaaagtcaagactgatacagtaattattctatgtagaaagaaagcagaa
aacacaagatgggactacttaacacaggtggaaaaggaatgcaaagagaaagaaaagcct
tcctacgacacggaggcagaccctagtgagggattaatgaatgttctaaagaaaatttat
gaagacggagacgatgatatgaagcgaaccattaataaagcgtgggtggaatccagagag
aagcaagccagagaagacacggaattttga

DBGET integrated database retrieval system