KEGG   Mus musculus (mouse): 12305Help
Entry
12305             CDS       T01002                                 

Gene name
Ddr1, 6030432F18, AI323681, CD167a, Cak, Nep, PTK3A
Definition
(RefSeq) discoidin domain receptor family, member 1
  KO
K05124  discoidin domain receptor family member 1 [EC:2.7.10.1]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    12305 (Ddr1)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    12305 (Ddr1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     12305 (Ddr1)
Protein kinases [BR:mmu01001]
 Receptor tyrosine kinases (RTK)
  DDR family
   12305 (Ddr1)
CD molecules [BR:mmu04090]
 Proteins
  12305 (Ddr1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase F5_F8_type_C Haspin_kinase Kinase-like
Motif
Other DBs
NCBI-GeneID: 12305
NCBI-ProteinID: NP_001185760
MGI: 99216
Ensembl: ENSMUSG00000003534
Vega: OTTMUSG00000031017
UniProt: Q03146 Q544T2 Q05BN5
Position
17 B1; 17 18.7 cM
AA seq 911 aa AA seqDB search
MGTGTLSSLLLLLLLVTIGDADMKGHFDPAKCRYALGMQDRTIPDSDISVSSSWSDSTAA
RHSRLESSDGDGAWCPAGPVFPKEEEYLQVDLRRLHLVALVGTQGRHAGGLGKEFSRSYR
LRYSRDGRRWMDWKDRWGQEVISGNEDPGGVVLKDLGPPMVARLVRFYPRADRVMSVCLR
VELYGCLWRDGLLSYTAPVGQTMQLSEVMVHLNDSTYDGYTAGGLQYGGLGQLADGVVGL
DDFRQSQELRVWPGYDYVGWSNQSFPTGYVEMEFEFDRLRTFQTMQVHCNNMHTLGARLP
GGVECRFKRGPAMAWEGEPVRHALGGSLGDPRARAISVPLGGHVGRFLQCRFLFAGPWLL
FSEISFISDVVNDSSDTFPPAPWWPPGPPPTNFSSLELEPRGQQPVAKAEGSPTAILIGC
LVAIILLLLLIIALMLWRLHWRRLLSKAERRVLEEELTVHLSVPGDTILINNRPGPREPP
PYQEPRPRGTPPHSAPCVPNGSALLLSNPAYRLLLATYARPPRGPGPPTPAWAKPTNTQA
CSGDYMEPEKPGAPLLPPPPQNSVPHYAEADIVTLQGVTGGNTYAVPALPPGAVGDGPPR
VDFPRSRLRFKEKLGEGQFGEVHLCEVEDPQDLVSSDFPISVHKGHPLLVAVKILRPDAT
KNARNDFLKEVKIMSRLKDPNIIRLLGVCVQDDPLCMITDYMENGDLNQFLSARQLENKA
TQGLSGDTESDQGPTISYPMLLHVGAQIASGMRYLATLNFVHRDLATRNCLVGENFTIKI
ADFGMSRNLYAGDYYRVQGRAVLPIRWMAWECILMGKFTTASDVWAFGVTLWEVLMLCRS
QPFGQLTDEQVIENAGEFFRDQGRQVYLSRPPACPQTLYELMLRCWSREPEQRPPFAQLH
RFLADDALNTV
NT seq 2736 nt NT seq  +upstreamnt  +downstreamnt
atggggacagggaccctctcatctctactgctgctgctactcttggtgacaattggagat
gctgacatgaagggacattttgaccctgccaagtgccgctatgccctgggcatgcaggac
cgcaccattcctgacagcgatatctctgtgtccagctcctggtcggactctaccgctgcc
cgccacagcaggctggaaagcagtgatggagatggggcttggtgccctgcagggcctgtg
ttccccaaagaagaggagtacttgcaggtggaccttcgtaggctacacctggtggctctg
gtgggcacccagggccgccatgctgggggtctgggcaaagagttctcccgaagctatcgg
ttgcgttactcccgagatggccgccgctggatggactggaaggaccgctggggacaggag
gtgatttcgggtaacgaggatcccgggggagtagtgctgaaggaccttgggccccccatg
gtggcccggctggtccgcttctaccccagggctgaccgggtcatgagtgtctgtcttcgg
gtggagctctatggctgcctctggcgggatggactcctgtcatatacagcccccgtgggg
cagaccatgcagttatctgaggtgatggtacatctcaatgattccacttacgatggatat
actgctggagggctgcagtatggcggtctgggccagctggcagatggcgtggtgggcctg
gatgatttcaggcagagccaggagctgcgggtctggccaggctatgactatgtgggatgg
agcaatcagagcttccccacgggctacgtggagatggagtttgagtttgatcggttgagg
accttccagaccatgcaggtccactgtaacaacatgcacactctgggagcccgcctacca
ggcggggtggaatgccggtttaaaaggggtcccgccatggcctgggaaggagagcctgtc
cgccatgctctgggaggcagccttggagaccccagagcccgggccatctcagtgcccctg
ggtggccacgtgggccgctttctgcagtgcagattcctctttgcaggtccttggttactc
ttcagtgagatctctttcatctcagatgtggtgaacgactcctctgacaccttcccacca
gccccctggtggccacctggcccgcctcccaccaacttcagcagcttggagctggagccc
cggggtcaacagccagtggccaaggcggaggggagcccaactgccatcctcattggctgc
ctggtggccatcatcctgctgctgcttctcatcatcgcgctgatgctctggaggctgcac
tggcgccggctgctcagcaaggctgagcgccgcgtgttggaggaggagctgacggttcac
ctttctgtccctggggacaccatcctcatcaacaaccgcccaggaccccgagagccaccc
ccttaccaggagccccggcctcgggggactccaccccattctgcaccctgcgtccccaac
ggctctgcgttgctgctctccaatccggcctaccgcctccttctggccacttacgcccgt
ccccctcgaggcccgggcccccccacacccgcctgggccaaacccaccaacacccaggcc
tgcagtggggactatatggagcccgagaagccgggtgccccgcttctacccccacctccc
cagaacagcgtcccccattatgccgaagctgacattgtcaccctgcagggcgtcactggg
ggcaacacctacgctgtgcctgcactgcccccaggggcggttggggatgggccccccaga
gtggatttccctcggtcacggctccgcttcaaggagaagcttggcgagggccaatttggg
gaggtacacctgtgtgaagtagaggacccgcaagatctggtcagtagtgacttccctatc
agtgtgcacaagggacaccccttgctggtagcagtgaagatcctccggccagatgccacc
aaaaatgccaggaatgatttcctgaaggaggtaaagatcatgtcacggctgaaggaccca
aacatcatccggctcctgggtgtgtgtgtgcaggatgaccccctctgcatgatcacagac
tacatggagaacggcgatctgaaccagttcctcagtgcccgccagctggagaacaaggcc
actcaggggctctctggggacacagagtctgaccaggggcccacaatcagctaccctatg
ctgttacacgtgggggcccagatcgcctctggcatgcgttatctcgccacgctgaacttt
gtgcatcgggacctggccacccggaactgcttggttggggaaaatttcaccatcaaaatc
gccgactttggcatgagccggaatctctacgctggggattattaccgtgtccagggccgg
gcggtgctgcccatcaggtggatggcttgggagtgcattctcatggggaagttcacaaca
gccagtgacgtttgggccttcggagtgaccctgtgggaggtgctgatgctctgcaggtcc
cagccctttgggcagcttacagatgagcaggttatcgagaatgccggcgagttcttcagg
gaccagggccggcaggtctacttgtccaggccacccgcctgcccacagaccctgtatgag
ctgatgctccggtgttggagccgggagcccgagcagcggccgcccttcgcccagcttcat
cggttcctggcggatgatgcgctcaacacggtgtaa

DBGET integrated database retrieval system