KEGG   Mus musculus (house mouse): 12306
Entry
12306             CDS       T01002                                 
Symbol
Anxa2, Cal1h, PAP-IV, p36
Name
(RefSeq) annexin A2
  KO
K17092  annexin A2
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    12306 (Anxa2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    12306 (Anxa2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    12306 (Anxa2)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    12306 (Anxa2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   12306 (Anxa2)
SSDB
Motif
Pfam: Annexin HAMP_2
Other DBs
NCBI-GeneID: 12306
NCBI-ProteinID: NP_031611
MGI: 88246
Ensembl: ENSMUSG00000032231
UniProt: P07356 Q542G9
Structure
Position
9:69360965..69399074
AA seq 339 aa
MSTVHEILCKLSLEGDHSTPPSAYGSVKPYTNFDAERDALNIETAVKTKGVDEVTIVNIL
TNRSNVQRQDIAFAYQRRTKKELPSALKSALSGHLETVILGLLKTPAQYDASELKASMKG
LGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEKDIISDTSGDFRKLMVALAKGRRA
EDGSVIDYELIDQDARELYDAGVKRKGTDVPKWISIMTERSVCHLQKVFERYKSYSPYDM
LESIKKEVKGDLENAFLNLVQCIQNKPLYFADRLYDSMKGKGTRDKVLIRIMVSRSEVDM
LKIRSEFKRKYGKSLYYYIQQDTKGDYQKALLYLCGGDD
NT seq 1020 nt   +upstreamnt  +downstreamnt
atgtctactgtccacgaaatcctgtgcaagctcagcctggagggtgatcattctacaccc
ccaagtgcctacgggtcagtcaaaccctacaccaacttcgatgctgagagggatgctctg
aacattgagacagcagtcaagaccaaaggagtggatgaggtcaccattgtcaacatcctg
acaaaccgcagcaatgtgcagaggcaggacattgccttcgcctatcagagaaggaccaaa
aaggagctcccgtcagcgctgaagtcagccttatctggccacctggagacggtgattttg
ggcctattgaagacacctgcccagtatgatgcttcggaactaaaagcttccatgaagggc
ctggggactgacgaggactccctcattgagatcatctgctcacgaaccaaccaggagctg
caagagatcaacagagtgtacaaggaaatgtacaagactgatctggagaaggacatcatc
tctgacacatctggagacttccgaaagctgatggtcgcccttgcaaagggcagacgagca
gaggatggctcagttattgactacgagctgattgaccaggatgcccgggagctctatgat
gccggggtgaagaggaaaggaaccgacgtccccaagtggatcagcatcatgactgagcgc
agtgtgtgccacctccagaaagtgttcgaaaggtacaagagctacagcccttatgacatg
ctggagagcatcaagaaagaggtcaaaggggacctggagaacgccttcctgaacctggtc
cagtgcatccagaacaagcccctgtacttcgctgaccggctgtacgactccatgaagggc
aaggggactcgagacaaggtcctgattagaatcatggtctctcgcagtgaagtggacatg
ctgaaaatcagatctgaattcaagaggaaatatggcaagtccctgtactactacatccag
caagacaccaagggtgactaccagaaggcactgctgtacctgtgtggtggggatgactga

DBGET integrated database retrieval system