KEGG   Mus musculus (mouse): 12306
Entry
12306             CDS       T01002                                 

Gene name
Anxa2, AW215814, Cal1h
Definition
(RefSeq) annexin A2
  KO
K17092  annexin A2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    12306 (Anxa2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    12306 (Anxa2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    12306 (Anxa2)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    12306 (Anxa2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   12306 (Anxa2)
SSDB
Motif
Pfam: Annexin HAMP_2 DUF2603
Other DBs
NCBI-GeneID: 12306
NCBI-ProteinID: NP_031611
MGI: 88246
Ensembl: ENSMUSG00000032231
Vega: OTTMUSG00000030907
UniProt: P07356 Q542G9
Structure
PDB: 
4HRE

Position
9 C; 9 38.58 cM
AA seq 339 aa
MSTVHEILCKLSLEGDHSTPPSAYGSVKPYTNFDAERDALNIETAVKTKGVDEVTIVNIL
TNRSNVQRQDIAFAYQRRTKKELPSALKSALSGHLETVILGLLKTPAQYDASELKASMKG
LGTDEDSLIEIICSRTNQELQEINRVYKEMYKTDLEKDIISDTSGDFRKLMVALAKGRRA
EDGSVIDYELIDQDARELYDAGVKRKGTDVPKWISIMTERSVCHLQKVFERYKSYSPYDM
LESIKKEVKGDLENAFLNLVQCIQNKPLYFADRLYDSMKGKGTRDKVLIRIMVSRSEVDM
LKIRSEFKRKYGKSLYYYIQQDTKGDYQKALLYLCGGDD
NT seq 1020 nt   +upstreamnt  +downstreamnt
atgtctactgtccacgaaatcctgtgcaagctcagcctggagggtgatcattctacaccc
ccaagtgcctacgggtcagtcaaaccctacaccaacttcgatgctgagagggatgctctg
aacattgagacagcagtcaagaccaaaggagtggatgaggtcaccattgtcaacatcctg
acaaaccgcagcaatgtgcagaggcaggacattgccttcgcctatcagagaaggaccaaa
aaggagctcccgtcagcgctgaagtcagccttatctggccacctggagacggtgattttg
ggcctattgaagacacctgcccagtatgatgcttcggaactaaaagcttccatgaagggc
ctggggactgacgaggactccctcattgagatcatctgctcacgaaccaaccaggagctg
caagagatcaacagagtgtacaaggaaatgtacaagactgatctggagaaggacatcatc
tctgacacatctggagacttccgaaagctgatggtcgcccttgcaaagggcagacgagca
gaggatggctcagttattgactacgagctgattgaccaggatgcccgggagctctatgat
gccggggtgaagaggaaaggaaccgacgtccccaagtggatcagcatcatgactgagcgc
agtgtgtgccacctccagaaagtgttcgaaaggtacaagagctacagcccttatgacatg
ctggagagcatcaagaaagaggtcaaaggggacctggagaacgccttcctgaacctggtc
cagtgcatccagaacaagcccctgtacttcgctgaccggctgtacgactccatgaagggc
aaggggactcgagacaaggtcctgattagaatcatggtctctcgcagtgaagtggacatg
ctgaaaatcagatctgaattcaagaggaaatatggcaagtccctgtactactacatccag
caagacaccaagggtgactaccagaaggcactgctgtacctgtgtggtggggatgactga

DBGET integrated database retrieval system