KEGG   Mus musculus (mouse): 12307
Entry
12307             CDS       T01002                                 

Gene name
Calb1, Bra, Brain-2, CB, Ca, Calb, Calb-1, cal
Definition
(RefSeq) calbindin 1
  KO
K14757  calbindin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04961  Endocrine and other factor-regulated calcium reabsorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    12307 (Calb1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    12307 (Calb1)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 EF-hand domain-containing proteins
  Other EF-hand domain-containing proteins
   12307 (Calb1)
Motif
Pfam: EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_5 EF-hand_8
Other DBs
NCBI-GeneID: 12307
NCBI-ProteinID: NP_033918
MGI: 88248
Ensembl: ENSMUSG00000028222
Vega: OTTMUSG00000004637
UniProt: P12658
Position
4 A2; 4 6.66 cM
AA seq 261 aa
MAESHLQSSLITASQFFEIWLHFDADGSGYLEGKELQNLIQELLQARKKAGLELSPEMKS
FVDQYGQRDDGKIGIVELAHVLPTEENFLLLFRCQQLKSCEEFMKTWRKYDTDHSGFIET
EELKNFLKDLLEKANKTVDDTKLAEYTDLMLKLFDSNNDGKLELTEMARLLPVQENFLLK
FQGIKMCGKEFNKAFELYDQDGNGYIDENELDALLKDLCEKNKQELDINNITTYKKNIMA
LSDGGKLYRTDLALILSAGDN
NT seq 786 nt   +upstreamnt  +downstreamnt
atggcagaatcccacctgcagtcatctctgatcacagcctcacagttttttgagatctgg
cttcatttcgacgctgacggaagtggttacctggaaggaaaggagctgcagaacttgatc
caggagcttctgcaggcgcgaaagaaggctggattggagctatcaccggaaatgaaatcc
tttgtggatcaatatggacagagagatgatggaaaaataggaattgtagagttggctcac
gtcttacccacagaagagaatttcttgctgctctttcgatgccagcaactgaagtcctgc
gaggaattcatgaagacttggagaaagtatgatactgaccacagcggcttcatcgaaacc
gaggaacttaagaactttctaaaggacctactagagaaagcaaacaagactgtggatgat
acaaaactagcagagtacacagacctcatgctgaaactatttgattcaaataatgacgga
aagctggaactgacagagatggccaggttactaccagtgcaggaaaatttccttcttaaa
ttccagggaatcaaaatgtgtgggaaagagttcaataaggcttttgagttatatgatcag
gatggcaacggatacatagatgaaaatgagctggatgctttgctgaaagatctgtgtgag
aagaacaaacaggaattggatattaacaatattactacatacaagaagaacataatggcc
ttgtcggatggagggaagctgtaccgaacagaccttgctcttattctttctgctggagac
aactag

DBGET integrated database retrieval system