KEGG   Mus musculus (mouse): 12308
Entry
12308             CDS       T01002                                 

Gene name
Calb2, C, CR, cal
Definition
(RefSeq) calbindin 2
  KO
K23908  calretinin
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    12308 (Calb2)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 EF-hand domain-containing proteins
  Other EF-hand domain-containing proteins
   12308 (Calb2)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_5 EF-hand_8
Other DBs
NCBI-GeneID: 12308
NCBI-ProteinID: NP_031612
MGI: 101914
Ensembl: ENSMUSG00000003657
Vega: OTTMUSG00000061890
UniProt: Q08331
Position
8; 8 D3
AA seq 271 aa
MAGPQQQPPYLHLAELTASQFLEIWKHFDADGNGYIEGKELENFFQELEKARKGSGMMSK
SDNFGEKMKEFMQKYDKNSDGKIEMAELAQILPTEENFLLCFRQHVGSSAEFMEAWRKYD
TDRSGYIEANELKGFLSDLLKKANRPYDEPKLQEYTQTILRMFDLNGDGKLGLSEMSRLL
PVQENFLLKFQGMKLTSEEFNAIFTFYDKDGSGYIDENELDALLKDLYEKNKKEMNIQQL
TTYRKSVMSLAEAGKLYRKDLEIVLCSEPPV
NT seq 816 nt   +upstreamnt  +downstreamnt
atggctggcccgcagcagcagcccccttacctgcacctggccgagctgactgcatcccag
ttcctggaaatctggaagcactttgatgctgacggaaatgggtacattgaaggtaaagag
ctagagaacttcttccaggagctggagaaggcaaggaagggttctggcatgatgtccaag
agcgacaattttggagagaagatgaaggagttcatgcagaagtatgataagaactcagat
gggaaaattgagatggcggagctggcgcagatcctgccgaccgaagagaatttccttttg
tgcttcaggcagcacgtgggctccagcgctgagtttatggaggcttggcggaagtatgac
acagacagaagtggctacatcgaagccaatgagctcaagggattcctgtctgacctcctg
aagaaggccaacaggccctatgatgaacctaagctccaggagtacacccagaccatacta
cggatgtttgacttaaatggagatggcaaattgggtctctcagagatgtctagactcttg
cctgtacaagagaacttcctgctgaaatttcagggtatgaagctgacctcagaagagttc
aatgccatcttcacattttatgacaaggatggaagcggctatattgatgagaatgaactg
gacgccctcctgaaggatctgtatgagaagaacaagaaggagatgaacatccaacagctc
accacctacaggaagagtgtcatgtccttggccgaggcagggaagctctacagaaaggac
ctggagattgtgctctgcagtgagccccccgtgtaa

DBGET integrated database retrieval system