KEGG   Mus musculus (mouse): 12311Help
Entry
12311             CDS       T01002                                 

Gene name
Calcr, Clr, Ct-r
Definition
(RefSeq) calcitonin receptor
  KO
K04576  calcitonin receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04380  Osteoclast differentiation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    12311 (Calcr)
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    12311 (Calcr)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    12311 (Calcr)
G protein-coupled receptors [BR:mmu04030]
 Secretin receptor family
  Calcium-regulating peptide
   Calcitonin
    12311 (Calcr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_2 HRM Dicty_CAR
Motif
Other DBs
NCBI-GeneID: 12311
NCBI-ProteinID: NP_031614
MGI: 101950
Ensembl: ENSMUSG00000023964
Vega: OTTMUSG00000035628
UniProt: Q60755
Position
6 A1; 6 1.81 cM
AA seq 533 aa AA seqDB search
MTPRRSRVKRRNLRKPKMRFLLVNRFTLLLLLLVSPTPVLQAPTNLTDSGLDQEPFLYLV
GRKKLLDAQYKCYDRIHQLPSYEGEGLYCNRTWDGWMCWDDTPAGATAYQHCPDYFPDFD
TAEKVSKYCDENGEWFRHPDSNRTWSNYTLCNAFTSEKLQNAYVLYYLALVGHSLSIAAL
VASMLIFWIFKNLSCQRVTLHKHMFLTYILNSIIIIIHLVEVVPNGDLVRRDPMHIFHHN
THMWTMQWELSPPLPLSAHEGKMDPHASEVISCKVLHFLHQYMMSCNYFWMLCEGIYLHT
LIVMAVFTDEQRLRWYYLLGWGFPIVPTIIHAITRALYYNDNCWLSAETHLLYIIHGPVM
VALVVNFFFLLNIVRVLVTKMRQTHEAESYMYLKAVKATMVLVPLLGIQFVVFPWRPSNK
VLGKIYDYLMHSLIHFQGFFVATIYCFCNHEVQVTLKRQWTQFKIQWSQRWGRRRRPTNR
VVSAPRAVAFAEPDGLPIYICHQEPRNPPISNNEGEESTEMIPMNVIQQDASA
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgactccaaggaggtccagagtgaaaaggcggaatctccgcaaaccgaagatgaggttc
cttctcgtgaacaggttcaccctgctgctcctgctcctagtgagcccaactccagttctt
caggctcctaccaatctcactgactccggccttgatcaggagccattcctgtacttggtt
ggccgcaagaagctgctggatgctcagtacaaatgctatgaccggattcatcagttgccc
tcttatgaaggagaaggtctgtactgcaaccgcacctgggatggctggatgtgctgggac
gacactcccgctggagccacagcctatcagcactgccctgactacttcccggactttgac
acagcagaaaaggtttcaaaatactgtgatgaaaatggagagtggtttagacaccctgac
agcaaccgaacctggtccaactatactctgtgcaacgctttcacttctgagaaactgcaa
aatgcgtacgttctttattacctggctcttgtgggtcactccttgtcgattgctgctttg
gttgcttccatgctgatcttctggattttcaagaaccttagctgccagagggtgaccttg
cacaagcacatgttccttacttatattctgaattctatcattatcatcatccacctggtt
gaggttgtgcccaatggagatctggtgcggcgggatcctatgcatatttttcatcataac
acacatatgtggacaatgcagtgggaactgtcaccacccttacccctgagtgcacacgag
ggaaagatggaccctcatgccagtgaagtgataagttgcaaggttctacactttttacat
cagtacatgatgtcttgcaactacttctggatgctctgcgaggggatctatcttcatact
ctgattgtcatggctgtgtttaccgacgagcaacgcctacgctggtactatcttcttggc
tgggggttcccgatagtgccaaccattatccacgccatcactcgtgccctctactacaac
gacaactgctggctgagtgcagaaacccacttgctttacatcatccatggacccgtcatg
gtggctctggtggtcaacttcttctttcttctcaacattgtccgcgtgcttgtgaccaag
atgaggcaaacccacgaggccgagtcctacatgtacctgaaggctgtgaaggccaccatg
gtccttgtgcccctgctggggatccagtttgttgtgtttccctggaggccctccaacaag
gtgcttgggaagatctatgattatctcatgcactctctgattcatttccagggattcttt
gtggcgactatctactgcttctgcaaccatgaggtgcaagtcaccctgaagcgccagtgg
acgcagttcaagatccagtggagccaacgctggggaaggcgccgccgccccaccaaccgc
gtagttagtgctcctcgggctgtagccttcgctgagccagatggcctccccatttacatc
tgccatcaggaaccacggaatcctccaatcagcaacaacgaaggcgaggagagtactgaa
atgatccccatgaacgtcatccagcaagacgcatccgcttga

DBGET integrated database retrieval system