KEGG   Mus musculus (mouse): 12316Help
Entry
12316             CDS       T01002                                 

Gene name
Aspm, Calmbp1, D330028K02Rik, MCPH5, Sha1
Definition
(RefSeq) abnormal spindle microtubule assembly
  KO
K16743  abnormal spindle-like microcephaly-associated protein
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    12316 (Aspm)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    12316 (Aspm)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IQ ASH CH CAMSAP_CH CH_2 TMEM131_like
Motif
Other DBs
NCBI-GeneID: 12316
NCBI-ProteinID: NP_033921
MGI: 1334448
Ensembl: ENSMUSG00000033952
Vega: OTTMUSG00000019630
UniProt: Q8CJ27
Position
1; 1 E4-F
AA seq 3122 aa AA seqDB search
MATMQAASCPEERGRRARPDPEAGDPSPPVLLLSHFCGVPFLCFGDVRVGTSRTRSLVLH
NPHEEPLQVELSLLRAAGQGFSVAPNRCELKPKEKLTISVTWTPLREGGVREIVTFLVND
FLKHQAILLGNAEEPKKKKRSLWNTSKKIPASSKHTKRTSKNQHFNESFTISQKDRIRSP
LQPCENLAMSECSSPTENKVPTPSISPIRECQSETCLPLFLRESTAYSSLHESENTQNLK
VQDASISQTFDFNEEVANETFINPISVCHQSEGDRKLTLAPNCSSPLNSTQTQIHFLSPD
SFVNNRYTSDNDLKSMKNVLSDTFRKDPAESVCLESQTVHEVCQTILSPDSFLNDNYGLK
KGLNFKSVNPVLSPTQFVKDSMGHVGQQTGKSNEASQDWRINEGLAYTPECQHAQTPSSR
SEKQNPVEVKPHTYDFTKQKPKISEFQDAFCHQSKQPHKRRPILSATVTKRKPTNAREKL
PEINKPDAKRCLEGLVGERGKEVGSLREKGFHSSLPVVEPGVSKALSYRDEVTPATVVVA
RKRKSHGTVGDANGKVAAEEWMDMCEVKRIHFSPLESTPSTVARTTKKEGHTSKRISSLE
RSGLKKKMDSSILKTPLSKTKKKRRSIVAVAQSHLTFIKPLKAAIPRHPMPFAAKNMFYD
ERWKEKQEQGFTWWLNYILTPDDFTVKTNVSKVNAASLVLGAESQHKISVPKAPTKEEVS
LRAYTASCRLNRLRRTACSLFTSEKMVKAIKKVEIEIEVGRLLVRKDRHLWKDIGQRQKV
LNWLLSYNPLWLRIGLETVFGELIPLADNSDVTGLAMFILNRLLWNPDIAAEYRHPTVPL
LFRDGHEAALSKFTLKKLLLLICFLDHAKISRLIDHDPCLFCKDAEFKASKELLLAFSRD
FLSGEGDLSRHLSFLGLPVSHVQTPLDEFDFAVTNLAVDLQCGVRLVRTVELLTQNWNLS
DKLRIPAISRVQKMHNVDLVLQVLKSRGVPLTDEHGSAISSKDVVDRHREKTLGLLWKIA
LAFQVDISLNLDQLKEEIDFLKHTHSIKRAMSALTCPSQAITNKQRDKRISGNFERYGDS
VQLLMDWVNAVCAFYNKKVENFTVSFSDGRILCYLIHHYHPCYVPFDAICQRTSQSVACA
QTGSVVLNSSSESEGGCLDLSLEALDHESTPEMYKELLENEKKNFHLVRSAARDLGGIPA
MIHHSDMSNTIPDEKVVITYLSFLCARLLDLRKEIRAARLIQTTWRKYKLKRDLKHHQER
DKAARVIQSVVLNFLSRRRLQKNVSAALVIQKCWRRVSAQRKLRMLKNEKLAKLQNKSAV
LIQAYWRRYSTRKRFLRLKHYSVILQSRIRMKIALTSYKRYLWATVTIQRHWRAYLSRKR
DQQIFRKLKSSSLVIQFMFRRWKRRKLQLQTKAAVTLQRAFREWHLRKQIRERSAVVIQS
WYRMHRELQKYIYIRSCVIVIQRRVRCFQAQKLYKRRKDAILTLQKHYRARQKGKLAHAD
YLQKRAATIRLQAAFRGMKARHSYRLQIGAACVLQSYWRMRQERVRFLNLKKMVIKLQAH
IRKYQQLQKYKKIKKAAITIQTHFRASISARRVLASYQKTRSSVIVLQSACRGMQARKAF
RHALASVIKIQSYYRAYICRKTFQNFKNATIKLQSIVKMKQSRKQYLQIRAAALFIQRWY
RSQKLASQKRKEYIQVRESCIKLQSHFRGCLVRKQLRLQCKAAISLQSYFRMRTARQRYL
KMCKAALVIQSFYCAYRAQISQRKNFLQVKRAAICLQAAYRGCKVRRQIKQQSTAAVTIQ
RVFRGHSQRMKYQTMLQSAVKIQRWYRAQKVAYDMRIQFLKTREAVVCLQSAYRGWQVRQ
QLRRQHEAAVKIQSTFRMAVAQQQYKLLRAAAAVIQQHVRARAAGKRQHLAYIQLRHAAL
VFQAAWKGKMLRRQIARQHQCAALIQSYYRMHIQRRKWSIMKTAALQIQLCYRAYKVGKE
QRHLYLKTKAAVVTLQSAYRGMKVRKRVAECHKAAVTIQSKFRAYRTQKKYTTYRTSAIV
IQRWYRNIKITTQQHQEYLNLRRAAVQVQAAYRGIRVRRRIQHMHMAATLIEAMFKMRQS
RVRYLKMRTAALIIQVRYRAYYLGKIQHEKYLRTLKAIKTLQAGVRGARVRRTVRKMHFA
ATLIQSHFRGHRQQTYFHRLRKAATMVQQRYRAVKEGSAEFQRYSRLRRSVLLIQAAFRG
LRTRRHLKAMHLAATLIQRRFRTFAMRRKFLSLRKTAIWIQRQYRARLYAKYSRQQLLLE
KAVIKIQSSYRGWVVRKRVQKMHRAATVIQATFRMHGAYMRYQHLKRASVVIQVHTAAEL
QRQKHAAVILQAAVRGMKTRSHLKTMHSSATLIQSQFRAFIVRRRFIALRKAAIFVQRKF
RATLYAKHKLHQFLQLRKAAITIQSSYRRLMVQKKLQEMHRAAALIQATFRMHRTYVAFH
IWKCASIRIQQCYRTYRTIKLQKEKLIREEQHSAAVLIQSTYRMYRQRCFYQQRRWAAKV
IQKTYRANKRRQDLLYVCKEETPLLQMHFQGLNTAKQGRQQHGAAMITQKHFRAFKARRL
MEAERGFQAGCRKYKAKKYLSKVEAACRIQAWYRRWRAHKKYLTLLKAVNIIEGYLSAQL
ARRRFLKMRAAAIIIQRKWRATLSVRGARENLKRHRAACVIQAHFRGYQARQSFLQQRSA
VLIIQRHVRAMVAAKQERIKYIKLKKSTVVVQALVRGWLVRKRVSEQKAKTRLFHFTAAA
YCHMCALKIQRAYRLHVTLRNAKKHMDSVIFIQRWFRKRLQRKRFIEQYHKILSTRREAH
ACWLQQDRAASVIQKAVRRFLLCRRQEKITSCATRIQALWRGYSWRKKNDHTEIKAIRRS
LRAVSTTVEEENKLYRRTERALHHLLTYKHLSAILDALKHLEVVTRLSPLCCENMAESGA
VSTIFVVIRSCNRSVPCMEVVGYAVQVLLNVAKYDKTIAAVYEAENCVDTLLELLQVYRE
KPGDRVAEKSASIFTRTCCLLAVLLKTEQCAFDAQSRSKVTDRIYRLYKFTVPKHKVNTQ
GLFDKQKQNSCVGFPCIPERTMKTRLVSRLKPQWVLRRDNVEEITNSLQAIQLVMDTLGI
SY
NT seq 9369 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgatgcaggcagcctcctgcccagaggagagggggcggcgggcgcgaccagat
cctgaggccggggacccgtctccgccggtgctgttgctcagccacttctgcggcgttccc
ttcctctgcttcggggatgtccgcgtgggcacgtcgcggacgcggtctctggtcctgcac
aacccgcacgaggaacctctgcaggtggagctgtcgctgctgcgcgccgcaggccagggc
ttcagcgtggcgccgaaccgctgcgagctgaagcctaaagaaaaacttaccatttccgtt
acctggacgccactgcgagaagggggagtgagggagattgtcacatttcttgtaaatgat
ttcctgaagcaccaggctatattactaggaaatgcagaagagcctaagaagaaaaagaga
agtctttggaataccagtaagaagattccagcctcttcaaaacatacaaaaaggacttcc
aaaaaccaacattttaatgaatcatttactatttcacaaaaagacagaattaggagccca
ctgcagccttgtgaaaatctggctatgagtgaatgctcttccccaacagaaaacaaagtc
cccaccccatccattagtcctattagagaatgccagagtgaaacttgcttgccactgttt
ttacgcgagtccactgcctattcatctcttcatgaatctgaaaatacacaaaatttaaaa
gtacaagatgccagcatttcacaaacttttgattttaatgaggaagtcgcaaatgaaact
tttattaatcccattagtgtctgtcaccagagtgaaggggataggaaactcacgcttgcc
ccaaactgttcttcacctttgaatagtacacagacccaaatacactttctaagtccagat
tcttttgtaaacaacaggtatacgtctgataatgacctgaaatcaatgaaaaatgtttta
tcagacacatttaggaaagatcccgcagagtctgtatgtctggaatcccaaactgtccat
gaagtttgccaaacaatcttaagcccagattcttttttaaatgataattatggacttaaa
aaagggctaaacttcaagtccgtcaatcccgttttgtcgccaacacaatttgtaaaggat
agcatgggacacgtaggtcagcaaacgggtaagtcaaatgaagcttctcaggattggaga
ataaatgaagggttggcgtatacccccgagtgtcagcatgcacagactcccagcagcaga
tctgaaaaacaaaaccctgtagaagtgaagccacatacgtatgattttacaaagcaaaag
cccaagatttctgagtttcaggatgctttttgtcaccagagtaaacaaccgcacaagaga
cgcccaattctttctgccactgttacgaaaaggaaacccaccaatgccagagaaaagcta
cctgagattaacaagccagacgcaaaaagatgtctcgaaggtctagtaggtgaacgtgga
aaagaagtgggtagcctgagagagaaaggttttcattcttctcttcccgttgtggagcca
ggagtgagtaaagctctgagctacagggatgaagtaacgcctgcaactgttgtcgttgct
cggaaaagaaagagccacggaacagtgggagatgcaaatggaaaagtagcagctgaagaa
tggatggacatgtgtgaagtcaaacgaatccatttttctcctctggaatctacaccctca
actgttgcaagaaccacaaagaaagaagggcatacctcaaagcggataagcagcctggag
cggtcaggcctgaagaagaaaatggattcatcaatattaaaaacacctctttctaagaca
aagaaaaagagaagatccattgttgctgtagcacagtctcatttgacctttataaagcca
ttaaaagcagctattcctagacacccaatgccgtttgctgcaaagaacatgttctatgac
gaacgctggaaggaaaagcaggaacagggcttcacttggtggctaaattatatattaaca
cctgatgacttcactgtaaaaaccaatgtttctaaagtgaacgctgccagccttgttttg
ggagcggaaagccaacataaaataagtgtcccgaaagcacctactaaagaggaagtgtct
ctcagagcttatacagccagctgcaggctgaatagattacgccgtacagcttgctccttg
tttacttctgaaaaaatggttaaagctattaaaaaggttgaaatcgaaattgaagttggg
cggctacttgttcgaaaagaccgacacctctggaaagatattggacaacgccaaaaagtc
ctgaattggctcttgtcatataatcctctgtggcttcgaattggtctggagacagttttt
ggagaactgatccctctggcagacaacagtgacgtcacgggattggcgatgttcattctg
aatcgcttactttggaatcctgacatagcagctgaatatagacaccccactgttcctctc
ctgtttcgggatggtcatgaagcagccttgtctaagttcacattgaaaaaattgctgttg
ttgatctgtttccttgatcatgctaaaatttccagacttattgatcatgatccttgtctc
ttctgtaaagatgctgaattcaaggctagcaaagagcttcttctagccttttcacgggat
ttcctcagtggtgaaggtgacctttctcgtcaccttagcttcttggggttacctgtgagc
cacgttcagacaccacttgatgaatttgattttgctgttacaaatcttgcagtggacttg
cagtgtggggttcgccttgtgcgaactgtggagcttctcacacagaactggaatctgtcc
gacaaactcaggatccctgcaataagtcgagttcaaaagatgcacaatgttgatctcgtc
cttcaggttctcaagtctcggggagttccactgactgacgagcatgggagcgctatctcg
tctaaggatgttgtggacaggcacagagagaaaacccttgggttgctttggaaaatagca
ctggctttccaggtggatatttcccttaatttagatcaattaaaagaagaaattgatttt
ctaaagcacacacacagtataaagagagctatgtctgcactaacatgcccttcacaagct
attactaataagcaaagagacaaaaggattagtgggaactttgaacgctatggtgacagt
gtgcagttgttgatggattgggtaaatgcagtttgtgccttctataataaaaaggtggag
aattttacagtgtctttctcagatggccgcatactatgctatttgatccaccattaccac
ccgtgctatgtgcctttcgatgctatatgccagcgcaccagtcagtccgtggcctgcgca
cagactggttcagtggtattgaattcttcatcggaatctgaaggaggttgtctggatctg
tctcttgaagcgcttgatcacgaaagtactccagaaatgtacaaagagcttctagaaaac
gagaagaaaaatttccatttggtgcgatctgcagctagggatctgggaggaatacctgct
atgattcatcattcagacatgtcaaatacaattccagacgaaaaggtggttatcacctat
ttgtcatttctttgtgcaaggcttttggatctccgtaaagaaataagagctgctcgactt
atacagacaacatggagaaaatataaactaaaaagagatctgaaacaccatcaggaaaga
gacaaagctgctagagttattcagtcagttgttctcaattttctaagtagacgaagattg
caaaaaaacgtcagtgcagctctggtcattcagaaatgctggcgaagagtctcagcgcaa
aggaagttgcggatgctgaaaaatgaaaaactggcaaaacttcaaaataaatcagcagtg
ctcattcaggcttattggagaagatactccaccagaaaacggtttctgaggttgaagcac
tattcagtcatccttcagtctaggataagaatgaaaattgctcttacatcttacaaacga
tatctttgggccacagttacaattcagaggcattggcgtgcctatttaagtagaaaacga
gatcagcaaatatttaggaagctgaaatcctcatcccttgtaatccagtttatgttcaga
aggtggaagcgacgcaagctgcagttacaaaccaaagctgcagtaacattgcagcgagct
tttagagaatggcatctcaggaaacaaatacgagaaagatccgctgttgtgatacagtca
tggtacagaatgcacagggaattgcagaaatacatttatattaggtcttgtgttattgtc
atccagagaagagttcggtgctttcaagcccaaaagttatataagagaaggaaagatgcc
atcctgactctccagaaacattacagggcacgtcagaaggggaagctagcacacgctgac
tatttgcagaaacgagctgccaccattcgactgcaggctgcattcagggggatgaaggct
cgccattcatacaggttgcagattggagctgcctgtgttcttcagtcctattggagaatg
agacaggaaagagttagatttttaaaccttaaaaagatggttattaagttgcaagcacac
ataagaaaataccaacaactacagaaatataagaagataaagaaagcagccattacaatt
cagactcatttccgagcttccatttcagccaggagggttctagcatcttatcagaaaaca
aggtcttcagtcattgttctacagtctgcatgtagagggatgcaagccagaaaagcattt
cgccatgctttagcatccgttataaagattcagtcatattatcgggcttatatatgtagg
aagacatttcagaacttcaaaaatgccacaataaagctgcagtcaattgtcaaaatgaaa
caatcacggaagcagtatttacaaataagagcagctgcactgtttatccagcggtggtac
cgttcccaaaaactggcctcacaaaagagaaaagagtacatacaggtgcgtgaatcctgt
atcaaactgcagtcacactttagaggatgcctggtcagaaagcagttgaggttgcaatgt
aaagctgccatttctctacagtcttatttcagaatgagaacagcgaggcagcgctacctg
aagatgtgcaaggcggctcttgtcattcagagtttctactgtgcctacagagcacaaatc
agtcaaaggaagaacttcttgcaggtcaaaagagcagctatttgtttgcaggcagcttac
agaggctgcaaagtacgccggcaaatcaagcagcagtctacggctgctgttacaattcag
agggtttttagaggccacagtcagaggatgaaataccagactatgcttcagtctgctgtg
aagattcagagatggtacagggcacagaaggttgcttatgacatgagaattcaatttcta
aagactagagaggctgtggtttgcctccagtctgcctaccgtggctggcaggttcggcaa
cagctcaggaggcaacatgaggctgcagtgaagatccagtctacgtttagaatggccgtg
gcccagcaacagtataaactactaagagcagctgcagcagtcatccagcagcatgtgagg
gcacgggctgcagggaagaggcagcacttggcgtacatccagctccgtcatgcagctctg
gtgtttcaggctgcatggaagggaaagatgctgagaagacagattgcccggcagcatcaa
tgcgctgccctcatacagtcatattacaggatgcacattcagcgcaggaagtggagcatc
atgaaaaccgctgcccttcagattcagctgtgctatagggcttacaaagttggaaaagaa
cagcgccacttatacttgaaaacaaaagcagctgtagtaactttacagtcagcttaccgt
ggtatgaaagtgagaaagcgggtagctgaatgccacaaagcagcggtcactatacagtct
aaatttagagcctacagaacacaaaagaagtacacgacctatagaacttcagctattgta
attcagaggtggtaccggaatattaaaattacaacccagcaacatcaggaataccttaac
ttaaggagggcagcagttcaagtccaggctgcgtatagaggcattagagtgaggagacgc
attcaacacatgcacatggcggccacacttattgaagccatgtttaagatgcgtcagtca
agagtaaggtacctcaagatgagaacagcagctcttataattcaggtgagatacagagcg
tattatctaggtaagattcagcatgagaagtacctgaggactttgaaggctattaaaacc
cttcaagctggagtcagaggagcaagagtgaggcggactgtaagaaagatgcatttcgca
gcaacactcattcagtcacattttaggggacacaggcagcaaacttactttcatcggttg
aggaaggcggcaaccatggtgcagcagagataccgagcagtgaaagaaggaagcgctgag
tttcagaggtacagcagactaaggcgttctgtactcctcatccaggctgccttcagggga
ctgagaactaggagacacttaaaagctatgcacctggctgctactctcattcagaggaga
ttcaggactttcgcgatgagaaggaagttcctttccctcaggaaaactgccatttggatt
cagagacagtaccgtgcaagactttatgccaagtattcccgacaacagttactgttggaa
aaggcagttataaagatccagtcatcatacagaggatgggtggtaaggaaaagggtgcaa
aagatgcacagggcggctactgtgattcaggccactttccggatgcacggagcctatatg
aggtaccagcatttgaagcgggcctcagttgtgatccaagtacacacagctgcagaactg
cagaggcaaaagcatgctgctgtaatccttcaggctgccgttagggggatgaaaaccaga
agtcatctgaagactatgcattcttctgcaacccttattcagagtcaatttagagctttt
atagtaaggagacgattcattgctctcagaaaagctgctatatttgtgcagaggaaattc
cgagccaccctttatgccaagcataaattgcaccaattcttgcagttacgaaaggcagcc
attaccatacagtcctcttatcgaagactgatggtacaaaagaagttacaagaaatgcac
agggctgcagctctcatccaggctacttttagaatgcacagaacttacgttgcatttcac
atttggaaatgtgcctcgattagaattcagcagtgttatcgaacatacagaactataaaa
ttacaaaaagaaaaacttatcagagaagaacaacacagtgctgctgtcctaatacaaagc
acgtacaggatgtacaggcagcgttgcttctatcaacagcgtcggtgggcagcaaaggta
atacaaaaaacatacagagcaaataaaagacggcaagatctgctctatgtgtgtaaggaa
gaaacacctcttcttcagatgcattttcagggtttaaacactgcaaaacaaggtcggcag
cagcatggggccgctatgattacacagaagcattttagagcctttaaagcaaggaggctg
atggaggccgagagaggcttccaggctggatgtagaaaatataaagctaagaaatactta
tccaaagtggaagctgcctgcaggattcaagcttggtataggcgttggagagcgcacaag
aaatatctaactttattgaaagctgttaacattattgaaggttacctctctgcacagctg
gcgagaaggaggttcttgaagatgagggcggcagctattataattcaaaggaaatggaga
gctacactttctgtaagaggagctcgtgagaatttaaaaagacatcgagctgcttgtgtg
attcaagcccactttaggggctatcaggcaaggcagtccttcctgcagcagagatctgct
gttttaatcatacagagacatgtacgagccatggtggctgcgaagcaggaaaggataaag
tatatcaaattgaaaaagtctacggttgttgtacaagccttggtgcgtggctggttagta
aggaaaagggtttcagagcagaaagccaaaactcggcttttccactttacagcagctgcc
tactgtcacatgtgtgctcttaaaatccaacgagcttatcggctccacgtgaccttgagg
aacgctaagaagcacatggattcagtcatcttcattcagagatggtttcgaaaaagatta
caacgaaagaggttcattgaacagtaccacaagatcctaagcactcgacgtgaagctcat
gcatgttggctccagcaggacagggctgcatccgtgatacagaaggcggtacgccgcttt
ctcctctgcagaagacaggaaaagatcactagctgcgccactagaattcaggcattatgg
agaggctattcttggaggaagaaaaatgaccacacagaaatcaaagctatccgacgaagc
cttagagctgtgagcacgaccgtggaggaggagaacaagctgtacagaagaactgagcga
gcgcttcatcacctgctcacctacaaacacttgtcggccattctggatgcgttgaagcac
ctggaggtcgttaccagactctctccactttgctgtgagaatatggctgaaagcggagcg
gtatctaccatctttgttgtgatccgaagctgtaatcggagtgttccttgtatggaagtc
gttggatatgctgttcaagtattgctgaatgtggcaaagtatgataagacgatcgcggct
gtgtacgaggccgagaactgcgtggacacactgctggagcttctgcaggtgtaccgagag
aagcctggagaccgagtcgctgagaagagtgccagcattttcacaagaacttgctgtttg
ttagcagtgctgttgaagacagagcagtgtgcttttgatgcacaaagtagatctaaagtc
actgatcgtatttatcgtctctacaaatttacagttcctaagcataaagtaaatacacag
ggattgtttgataagcagaagcagaattcctgtgtaggctttccttgtataccagaaaga
actatgaagaccaggttagtttcaagacttaagccacagtgggttttgaggcgtgataat
gtggaagaaattacaaactccctgcaagctattcaactggtaatggatacacttggaatt
tcttattag

DBGET integrated database retrieval system