KEGG   Mus musculus (mouse): 12317
Entry
12317             CDS       T01002                                 

Gene name
Calr, CR, CRT, Calregulin
Definition
(RefSeq) calreticulin
  KO
K08057  calreticulin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
mmu04145  Phagosome
mmu04612  Antigen processing and presentation
mmu05142  Chagas disease
mmu05163  Human cytomegalovirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    12317 (Calr)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    12317 (Calr)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    12317 (Calr)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    12317 (Calr)
   05170 Human immunodeficiency virus 1 infection
    12317 (Calr)
   05168 Herpes simplex virus 1 infection
    12317 (Calr)
   05163 Human cytomegalovirus infection
    12317 (Calr)
   05169 Epstein-Barr virus infection
    12317 (Calr)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    12317 (Calr)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mmu03110]
    12317 (Calr)
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:mmu04091]
    12317 (Calr)
Chaperones and folding catalysts [BR:mmu03110]
 Other chaperones and cochaperones
  Calnexin / calreticulin
   12317 (Calr)
Lectins [BR:mmu04091]
 Calnexin / calreticulin
  12317 (Calr)
SSDB
Motif
Pfam: Calreticulin MDM10 DDHD
Other DBs
NCBI-GeneID: 12317
NCBI-ProteinID: NP_031617
MGI: 88252
Ensembl: ENSMUSG00000003814
Vega: OTTMUSG00000022277
UniProt: P14211 B2MWM9
Structure
PDB: 
3O0W 3O0X 3O0V 3RG0

Position
8 C3; 8 41.21 cM
AA seq 416 aa
MLLSVPLLLGLLGLAAADPAIYFKEQFLDGDAWTNRWVESKHKSDFGKFVLSSGKFYGDL
EKDKGLQTSQDARFYALSAKFEPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPSGLDQK
DMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNVLINKDIRCKDDEFTHLYTLIVRPDN
TYEVKIDNSQVESGSLEDDWDFLPPKKIKDPDAAKPEDWDERAKIDDPTDSKPEDWDKPE
HIPDPDAKKPEDWDEEMDGEWEPPVIQNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYS
PDANIYAYDSFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQMKDK
QDEEQRLKEEEEDKKRKEEEEAEDKEDDDDRDEDEDEEDEKEEDEEESPGQAKDEL
NT seq 1251 nt   +upstreamnt  +downstreamnt
atgctcctttcggtgccgctcctgcttggcctcctcggcctggccgccgcagaccctgcc
atctatttcaaagagcagttcttggacggagatgcctggaccaaccgctgggtcgaatcc
aaacataagtccgattttggcaaatttgtcctcagttctggcaaattttacggggacctg
gagaaggataaagggctgcagacaagccaagatgcccgattttacgcactgtccgccaaa
ttcgaacccttcagcaataagggccagacactggtggtacagttcacggtgaagcatgag
cagaatatcgactgtgggggcggctacgtgaagctgtttccgagtggtttggaccagaag
gacatgcatggagactcagaatataacatcatgtttggtccggacatctgcggtcctggc
accaagaaggttcatgtcatctttaactacaagggcaagaatgtgctgatcaacaaggat
atccggtgtaaggatgatgaattcacacacctatacacactgattgtgcggccagacaac
acctatgaggtgaaaattgacaacagccaggtggagtcaggctccttggaggatgattgg
gactttctgccacccaagaagataaaggaccctgatgctgccaagccggaagactgggat
gaacgagccaagatcgatgaccccacagattccaagcctgaggactgggacaagccagag
cacatccctgaccctgatgctaagaagcctgaggactgggatgaagagatggatggagag
tgggaaccaccagtgattcaaaatcctgaatacaagggcgagtggaaaccacgtcaaatt
gacaacccagattacaagggtacctggatacacccagaaattgacaaccctgaatactcc
cccgatgcaaatatctatgcctatgatagttttgctgtactgggcctagatctctggcag
gtcaagtccgggacaatctttgacaatttcctcatcaccaatgatgaggcctatgcagag
gagtttggcaatgagacgtggggtgttaccaaggctgcagagaagcagatgaaggacaag
caggatgaggagcagaggcttaaggaagaagaagaggacaagaagcgtaaagaggaagaa
gaagctgaggataaagaggatgatgatgacagagatgaagatgaggacgaagaagatgag
aaggaggaagatgaggaagaatcccctggccaagccaaggatgagctgtag

DBGET integrated database retrieval system