KEGG   Mus musculus (house mouse): 12319
Entry
12319             CDS       T01002                                 
Symbol
Car8, Ca8, Cals, Cals1, Carp, wdl
Name
(RefSeq) carbonic anhydrase 8
  KO
K01672  carbonic anhydrase [EC:4.2.1.1]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00910  Nitrogen metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    12319 (Car8)
Enzymes [BR:mmu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.1  carbonic anhydrase
     12319 (Car8)
SSDB
Motif
Pfam: Carb_anhydrase
Other DBs
NCBI-GeneID: 12319
NCBI-ProteinID: NP_031618
MGI: 88253
Ensembl: ENSMUSG00000041261
UniProt: P28651
Position
4:complement(8141493..8239226)
AA seq 291 aa
MADLSFIEDAVAFPEKEEDEEEEEEEGVEWGYEEGVEWGLVFPDANGEYQSPINLNSREA
RYDPSLLDVRLSPNYVVCRDCEVTNDGHTIQVILKSKSVLSGGPLPQGQEFELYEVRFHW
GRENQRGSEHTVNFKAFPMELHLIHWNSTLFGSIDEAVGKPHGIAIIALFVQIGKEHVGL
KAVTEILQDIQYKGKSKTIPCFNPNTLLPDPLLRDYWVYEGSLTIPPCSEGVTWILFRYP
LTISQMQIEEFRRLRTHVKGAELVEGCDGILGDNFRPTQPLSDRVIRAAFQ
NT seq 876 nt   +upstreamnt  +downstreamnt
atggctgacctgagcttcattgaggatgcagtcgccttccccgagaaggaggaagacgag
gaagaggaggaggaggagggcgtggagtggggttacgaggaaggtgttgagtggggctta
gtgtttcctgatgctaatggggagtaccagtcacctatcaacctaaactccagagaagcc
aggtatgacccctcactgctggatgtccgcctgtctccaaattatgtggtgtgccgggac
tgtgaagtcaccaacgatggacacaccattcaagtcatcctgaagtcaaaatcagtcttg
tcaggaggaccactgcctcagggacaggagtttgagctgtatgaagttagatttcactgg
ggaagagaaaaccagcgtggttctgagcacacggtcaatttcaaagcctttcccatggag
ctccacctgatccactggaattccacactgtttggcagcatcgatgaggcggttgggaag
ccccatggtatcgccatcattgcactatttgttcagatcgggaaggaacatgttggcttg
aaggctgtgactgagatcctccaggatattcaatataagggaaaatccaaaacaattcca
tgctttaatcctaacactttattaccagaccctcttctgcgggattactgggtctatgaa
ggatctcttactatcccaccttgcagcgaaggagttacctggatattattccgataccct
ttaactatatcccagatgcagatagaagaatttcgaaggctgaggacacatgtcaagggg
gcagaactggtggagggctgcgatgggattttgggagacaatttccgacctacccagccc
ctgagtgatagagtcatccgagcggcctttcagtag

DBGET integrated database retrieval system