KEGG   Mus musculus (mouse): 12321
Entry
12321             CDS       T01002                                 

Symbol
Calu, 9530075H20Rik
Name
(RefSeq) calumenin
  KO
K23901  calumenin
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    12321 (Calu)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 EF-hand domain-containing proteins
  CREC family proteins
   12321 (Calu)
SSDB
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg
Other DBs
NCBI-GeneID: 12321
NCBI-ProteinID: NP_031620
MGI: 1097158
Ensembl: ENSMUSG00000029767
Vega: OTTMUSG00000024995
UniProt: O35887 Q3TUF3 Q3TQD1 Q3UG11
Position
6; 6 A3.3
AA seq 315 aa
MDLRQFLMCLSLCTAFALSKPTEKKDRVHHEPQLSDKVHNDAQNFDYDHDAFLGAEEAKS
FDQLTPEESKERLGKIVSKIDDDKDGFVTVDELKGWIKFAQKRWIHEDVERQWKGHDLNE
DGLVSWEEYKNATYGYVLDDPDPDDGFNYKQMMVRDERRFKMADKDGDLIATKEEFTAFL
HPEEYDYMKDIVVQETMEDIDKNADGFIDLEEYIGDMYSHDGNADEPEWVKTEREQFVEF
RDKNRDGKMDKEETKDWILPSDYDHAEAEARHLVYESDQNKDGKLTKEEIVDKYDLFVGS
QATDFGEALVRHDEF
NT seq 948 nt   +upstreamnt  +downstreamnt
atggacctgcgtcagtttcttatgtgcctgtccctgtgcacagcctttgctttgagcaag
cctacagaaaagaaggaccgagtacaccatgagcctcagctcagcgataaagttcacaat
gatgctcagaattttgactatgaccatgatgccttcttgggtgcagaagaggcaaagagt
tttgatcagctgacaccagaagagagcaaggaaaggcttggaaagattgtaagtaaaata
gatgacgacaaggatgggtttgtcactgtggatgaactcaaaggctggattaagtttgca
caaaagcgctggattcacgaggatgtagagcggcaatggaaggggcacgacctcaatgag
gatggcctcgtttcctgggaggagtataaaaatgccacctacggctacgttttagatgat
ccagatcctgatgatggatttaattataaacagatgatggtcagagatgagcggaggttt
aaaatggcagacaaggatggagacctaattgccacaaaggaagagttcacagctttcctg
caccctgaggaatatgactacatgaaagacatagtcgtgcaggaaaccatggaggatata
gacaagaatgctgatgggttcattgatctagaggagtacattggtgacatgtacagtcat
gatgggaatgctgatgagccagagtgggtgaagacagagcgagaacagttcgtggagttt
cgagataagaaccgggatgggaagatggacaaggaagagaccaaagactggatcctcccc
tcagactatgaccatgcagaggcagaagccaggcatctggtctatgagtcagaccaaaac
aaggatggcaagctcaccaaggaggagattgtcgacaagtatgatttatttgtgggcagc
caggccacagatttcggggaggccttagtacgacatgatgagttctga

DBGET integrated database retrieval system