KEGG   Mus musculus (mouse): 12330
Entry
12330             CDS       T01002                                 

Gene name
Canx, 1110069N15Rik, AI988026, CN, Cnx, D11Ertd153e
Definition
(RefSeq) calnexin
  KO
K08054  calnexin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
mmu04145  Phagosome
mmu04612  Antigen processing and presentation
mmu04918  Thyroid hormone synthesis
mmu05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    12330 (Canx)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    12330 (Canx)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    12330 (Canx)
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    12330 (Canx)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    12330 (Canx)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mmu03110]
    12330 (Canx)
   04131 Membrane trafficking [BR:mmu04131]
    12330 (Canx)
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:mmu04091]
    12330 (Canx)
Chaperones and folding catalysts [BR:mmu03110]
 Other chaperones and cochaperones
  Calnexin / calreticulin
   12330 (Canx)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Others
    12330 (Canx)
Lectins [BR:mmu04091]
 Calnexin / calreticulin
  12330 (Canx)
SSDB
Motif
Pfam: Calreticulin Connexin TRAP_alpha MAP17 COX16 V_ATPase_I Serinc SieB
Other DBs
NCBI-GeneID: 12330
NCBI-ProteinID: NP_001103969
MGI: 88261
Ensembl: ENSMUSG00000020368
Vega: OTTMUSG00000005582
UniProt: P35564 Q5SUC3
Position
11 B1.3; 11 30.46 cM
AA seq 591 aa
MEGKWLLCLLLVLGTAAVEAHDGHDDDAIDIEDDLDDVIEEVEDSKSKSDASTPPSPKVT
YKAPVPTGEVYFADSFDRGSLSGWILSKAKKDDTDDEIAKYDGKWEVDEMKETKLPGDKG
LVLMSRAKHHAISAKLNKPFLFDTKPLIVQYEVNFQNGIECGGAYVKLLSKTAELSLDQF
HDKTPYTIMFGPDKCGEDYKLHFIFRHKNPKTGVYEEKHAKRPDADLKTYFTDKKTHLYT
LILNPDNSFEILVDQSVVNSGNLLNDMTPPVNPSREIEDPEDRKPEDWDERPKIADPDAV
KPDDWDEDAPSKIPDEEATKPEGWLDDEPEYIPDPDAEKPEDWDEDMDGEWEAPQIANPK
CESAPGCGVWQRPMIDNPNYKGKWKPPMIDNPNYQGIWKPRKIPNPDFFEDLEPFKMTPF
SAIGLELWSMTSDIFFDNFIISGDRRVVDDWANDGWGLKKAADGAAEPGVVLQMLEAAEE
RPWLWVVYILTVALPVFLVILFCCSGKKQSNAMEYKKTDAPQPDVKDEEGKEEEKNKRDE
EEEEEKLEEKQKSDAEEDGVTGSQDEEDSKPKAEEDEILNRSPRNRKPRRE
NT seq 1776 nt   +upstreamnt  +downstreamnt
atggaagggaagtggttactgtgtttgctgctggtccttggaactgcagctgttgaggct
catgatggacatgatgatgacgcgattgatattgaagatgatcttgatgatgttattgaa
gaggtagaagattcaaaatctaaatcagatgccagcactcctccatctccaaaggtcacc
tacaaagctccagttccaacaggggaggtttattttgctgactcctttgacagagggtct
ctgtcagggtggattttatctaaagccaaaaaagatgacactgatgatgaaattgccaaa
tatgatggaaagtgggaagtagatgagatgaaggaaacaaagcttccaggggataaagga
cttgtactgatgtctcgggccaagcatcatgccatctctgctaaactgaataagcccttc
ctgtttgataccaagcctctcattgttcagtatgaggttaattttcagaatggaatagaa
tgtggtggtgcctatgtgaagctgctttccaagacggcagagctcagcctggatcaattc
cacgacaagactccctatactattatgtttggtccagataagtgtggagaggactacaaa
ctgcatttcatctttcgacacaaaaatcccaagacaggtgtatatgaagaaaaacatgct
aagaggccagatgcagatctgaagacctatttcactgacaagaaaacgcatctttataca
ttaatcttgaatccagacaatagttttgaaatattagttgaccagtctgttgtgaacagt
ggaaatctgctaaatgacatgactcctcctgtaaacccttcacgtgaaattgaagaccca
gaagaccggaagcctgaagattgggatgaaaggcccaaaatagcagatccagatgctgtc
aagccagatgactgggatgaagacgccccttctaagatcccagatgaagaggccaccaag
cctgaaggctggctagacgacgaacctgagtatattccagaccctgatgcagagaagcca
gaggattgggatgaggatatggacggagaatgggaggctcctcagattgccaaccccaag
tgtgagtcagcccctgggtgtggtgtctggcagcgacctatgattgacaaccccaattat
aagggcaaatggaagcctccaatgattgacaaccctaactaccagggaatctggaaacca
aggaaaataccaaatccagatttctttgaagacctagaaccttttaagatgactcctttc
agtgctattggtttggagctctggtccatgacatccgacatcttttttgacaactttatc
attagtggtgaccgaagagtagttgatgattgggccaatgatgggtggggcctgaagaaa
gctgctgatggggctgctgagccaggtgtagtgctgcagatgctggaggcagctgaagag
cgtccatggctttgggtggtctacattttgactgtagctttgccagtgttccttgtgatc
ctcttctgctgttctggaaagaaacagtccaatgctatggagtacaagaagacggatgct
ccccagccagatgtgaaggatgaagaagggaaggaagaagagaagaacaagagggatgaa
gaggaagaagaggagaagcttgaagagaaacagaagagtgatgctgaagaagatggtgtt
actggcagtcaagatgaggaagatagcaagcctaaagcagaggaggatgaaattttgaac
agatcgccaagaaacagaaagccacgaagagagtga

DBGET integrated database retrieval system