KEGG   Mus musculus (mouse): 12331Help
Entry
12331             CDS       T01002                                 

Gene name
Cap1
Definition
(RefSeq) CAP, adenylate cyclase-associated protein 1 (yeast)
  KO
K17261  adenylyl cyclase-associated protein
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    12331 (Cap1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    12331 (Cap1)
Membrane trafficking [BR:mmu04131]
 Others
  Actin-binding proteins
   Others
    12331 (Cap1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   12331 (Cap1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CAP_N CAP_C TBCC WH2 AKNA
Motif
Other DBs
NCBI-GeneID: 12331
NCBI-ProteinID: NP_001287996
MGI: 88262
Ensembl: ENSMUSG00000028656
Vega: OTTMUSG00000008872
UniProt: P40124
Structure
PDB: 

Position
4; 4 D2.2
AA seq 474 aa AA seqDB search
MADMQNLVERLERAVGRLEAVSHTSDMHCGYGDSPSKGAVPYVQAFDSLLANPVAEYLKM
SKEIGGDVQKHAEMVHTGLKLERALLATASQCQQPAGNKLSDLLAPISEQIQEVITFREK
NRGSKFFNHLSAVSESIQALGWVALAAKPGPFVKEMNDAAMFYTNRVLKEYRDVDKKHVD
WVRAYLSIWTELQAYIKEFHTTGLAWSKTGPVAKELSGLPSGPSVGSGPPPPPPGPPPPP
ISTSSGSDDSASRSALFAQINQGESITHALKHVSDDMKTHKNPALKAQSGPVRSGPKPFS
APKPQTSPSPKPATKKEPALLELEGKKWRVENQENVSNLVIDDTELKQVAYIYKCVNTTL
QIKGKINSITVDNCKKLGLVFDDVVGIVEIINSRDVKVQVMGKVPTISINKTDGCHAYLS
KNSLDCEIVSAKSSEMNVLIPTEGGDFNEFPVPEQFKTLWNGQKLVTTVTEIAG
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atggctgacatgcaaaatcttgtagaaagattggagagggcagtgggccgcctggaggca
gtgtcacatacttcagacatgcactgtggatatggagacagcccttcaaaaggagcagtt
ccatatgtgcaagcatttgactcgctgcttgccaatcccgtggcagagtacttgaagatg
agtaaggagatcgggggagatgtgcagaaacacgcggagatggtccacacaggcctgaag
ttggagcgagctctcctggctacagcttctcagtgccagcagccagctggtaataaactt
tctgatttgttggcacctatctcggagcagatccaagaagttataaccttccgggagaag
aaccgaggcagcaagttttttaatcatctatctgctgtcagtgaaagcatccaggccttg
ggctgggtggctctggctgcgaaacctggcccctttgtgaaagagatgaatgacgcggcc
atgttttacacaaatcgtgtcctcaaggagtacagagatgtggataagaagcatgtggac
tgggtcagagcttacttgagtatatggacggagctgcaggcttacatcaaggagtttcat
actactggcctggcctggagcaagacggggcctgtggcaaaagaactgagtggattgcca
tctggaccctctgtgggatcaggcccacctcctcccccaccgggcccgcctcctccccca
atctctaccagttctggttctgacgactctgcatcacgctcagcactgtttgcacagatt
aatcagggggaaagcatcacacatgccctgaaacatgtatctgatgacatgaagactcac
aagaaccctgccctgaaagctcagagtggtccagttcggagtggccccaaaccattctct
gcacctaaaccccaaactagcccctcccccaaaccagccacaaagaaggaaccagctctg
ctggaactggaaggcaagaaatggagagtggaaaaccaggagaatgtttccaacctggtg
atcgatgacactgagctgaagcaggtggcttacatctacaagtgtgtcaacacaacattg
caaatcaagggcaaaattaactccattacagtagataactgtaagaagcttggcctggtg
tttgatgacgtggtgggcattgtggagataatcaatagtagggatgtcaaagttcaggtg
atgggaaaagtgccaaccatttccattaacaaaacagatggctgccatgcttacctgagc
aagaactccctggactgtgagatagtcagtgccaaatcttctgagatgaatgtcctcatt
cctaccgaaggcggtgattttaacgagttcccagtccccgagcagttcaagaccctgtgg
aacggacagaagttggtcaccacagtgacagaaatcgctggataa

DBGET integrated database retrieval system