KEGG   Mus musculus (mouse): 12333Help
Entry
12333             CDS       T01002                                 

Gene name
Capn1, Capa-1, Capa1, mu-calpin
Definition
(RefSeq) calpain 1
  KO
K01367  calpain-1 [EC:3.4.22.52]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
mmu04210  Apoptosis
mmu04217  Necroptosis
mmu04218  Cellular senescence
mmu05010  Alzheimer's disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    12333 (Capn1)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    12333 (Capn1)
   04217 Necroptosis
    12333 (Capn1)
   04218 Cellular senescence
    12333 (Capn1)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    12333 (Capn1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.52  calpain-1
     12333 (Capn1)
Peptidases [BR:mmu01002]
 Cysteine Peptidases
  Family C2: calpain family
   12333 (Capn1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C2 Calpain_III EF-hand_8 EF-hand_6 EF-hand_1 EF-hand_7
Motif
Other DBs
NCBI-GeneID: 12333
NCBI-ProteinID: NP_001103974
MGI: 88263
Ensembl: ENSMUSG00000024942
UniProt: O35350 Q3TI07 Q3UF24 Q3TB79
Position
19 A; 19 4.34 cM
AA seq 713 aa AA seqDB search
MTEELITPVYCTGVSAQVQKKRDKELGLGRHENAIKYLGQDYETLRARCLQSGVLFQDEA
FPPVSHSLGFKELGPHSSKTYGIKWKRPTELMSNPQFIVDGATRTDICQGALGDCWLLAA
IASLTLNETILHRVVPYGQSFQDGYAGIFHFQLWQFGEWVDVVIDDLLPTKDGKLVFVHS
AQGNEFWSALLEKAYAKVNGSYEALSGGCTSEAFEDFTGGVTEWYDLQKAPSDLYQIILK
ALERGSLLGCSINISDIRDLEAITFKNLVRGHAYSVTGAKQVTYQGQRVNLIRMRNPWGE
VEWKGPWSDSSYEWNKVDPYEREQLRVKMEDGEFWMSFRDFIREFTKLEICNLTPDALKS
RTLRNWNTTFYEGTWRRGSTAGGCRNYPATFWVNPQFKIRLEEVDDADDYDNRESGCSFL
LALMQKHRRRERRFGRDMETIGFAVYQVPRELAGQPVHLKRDFFLANASRAQSEHFINLR
EVSNRIRLPPGEYIVVPSTFEPNKEGDFLLRFFSEKKAGTQELDDQIQANLPDEKVLSEE
EIDDNFKTLFSKLAGDDMEISVKELQTILNRIISKHKDLRTNGFSLESCRSMVNLMDRDG
NGKLGLVEFNILWNRIRNYLTIFRKFDLDKSGSMSAYEMRMAIEAAGFKLNKKLHELIIT
RYSEPDLAVDFDNFVCCLVRLETMFRFFKLLDTDLDGVVTFDLFKWLQLTMFA
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
atgacagaggagttaatcacccctgtgtactgcaccggggtgtcagcccaagtacagaag
aagcgggacaaggagctgggcttgggccgccatgaaaacgccatcaagtacctgggccag
gattatgaaacgcttcgggcaagatgcctgcagagtggggtcctcttccaagacgaggcc
ttccctccggtttctcatagcctgggcttcaaggaactgggtcctcattcctctaaaacc
tatggcatcaaatggaagcggcctacggaactgatgtcaaacccccagttcatcgtggat
ggagccacccggacagacatctgccagggagcactgggggactgttggctcctggctgcc
attgcctccctcaccctcaacgagactattctgcaccgagtggttccctacggccagagc
tttcaggatggctacgctggcatctttcatttccagctgtggcagttcggggagtgggtc
gacgtggtcatagatgacttgctgcccaccaaggacgggaagctggtgttcgtgcactct
gcccagggcaacgaattctggagcgcactgctggagaaagcctatgctaaagtgaatggc
agctatgaggctctttcgggaggctgcacctcagaggccttcgaggactttaccggtggg
gtcactgagtggtacgacctgcagaaggcccccagcgacctctaccagatcattctaaag
gccctggaacgaggctccttgctgggctgctccattaatatctccgatatccgtgattta
gaggctattacttttaagaacctggtgaggggccatgcgtactctgtgacgggcgccaag
caggtaacttaccagggccagcgggtgaacctaatccggatgcggaacccctggggtgaa
gtggagtggaaaggaccctggagtgacagctcctatgagtggaacaaagtggacccctat
gaacgagagcagctgagggtcaagatggaggatggggagttctggatgtcgttccgagac
ttcatccgtgaattcaccaaactggaaatctgcaaccttacaccggacgcccttaagagc
aggaccctccggaattggaataccacattttacgagggcacctggcgtcggggaagcacc
gctggaggctgcaggaactacccagctaccttctgggtaaacccccagttcaagatccgg
ttggaggaggtggatgacgcagacgactatgacaaccgggagtcgggctgcagcttcttg
ctggccctcatgcagaaacaccgccgcagggagcgtcgctttggccgggacatggagacc
atcggttttgcagtgtaccaggtccctcgggagctggcgggtcagcctgtgcacttgaag
cgtgatttcttcctggccaacgcttctcgggcgcagtcagagcacttcatcaaccttcgg
gaagtcagcaaccgtatccgcctgccgcccggggagtacatagtggtgccctccaccttc
gagcccaacaaagaaggcgacttcctgctgcgcttcttctcagagaagaaggctgggacc
caggaactagatgaccagatccaggccaacctccctgatgagaaagttctctctgaagag
gagattgatgacaacttcaagaccttgttcagcaagttggcaggggatgacatggagatc
agcgtcaaggagctacagaccatcttgaacaggatcattagcaaacacaaagacctgcgc
actaatggcttcagcctggagtcgtgccgcagcatggtgaacctcatggatcgagatggc
aacgggaagctgggtctggtggagttcaacatcctgtggaaccgcatccgaaattacctg
accatcttccggaagtttgacctggacaagtctggcagcatgagtgcctatgagatgagg
atggccatcgaggctgcaggcttcaagcttaacaagaagctgcatgaactcataatcacc
cgctactcggagcccgacctggccgtggactttgacaactttgtgtgctgtcttgtgcgg
ctggagaccatgttccggtttttcaaacttctggacacagacctggatggtgttgtgacc
tttgatctatttaagtggctccagctgactatgtttgcctga

DBGET integrated database retrieval system