KEGG   Mus musculus (mouse): 12334
Entry
12334             CDS       T01002                                 

Gene name
Capn2, AI326419, CALP80, Ca, Cap, Capa-2, Capa2, m-c, m-calpain, m-calpin
Definition
(RefSeq) calpain 2
  KO
K03853  calpain-2 [EC:3.4.22.53]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
mmu04210  Apoptosis
mmu04217  Necroptosis
mmu04218  Cellular senescence
mmu04510  Focal adhesion
mmu05010  Alzheimer disease
mmu05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    12334 (Capn2)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    12334 (Capn2)
   04217 Necroptosis
    12334 (Capn2)
   04218 Cellular senescence
    12334 (Capn2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    12334 (Capn2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    12334 (Capn2)
   05022 Pathways of neurodegeneration - multiple diseases
    12334 (Capn2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    12334 (Capn2)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.53  calpain-2
     12334 (Capn2)
Peptidases and inhibitors [BR:mmu01002]
 Cysteine peptidases
  Family C2: calpain family
   12334 (Capn2)
SSDB
Motif
Pfam: Peptidase_C2 Calpain_III EF-hand_1 EF-hand_6 EF-hand_8
Other DBs
NCBI-GeneID: 12334
NCBI-ProteinID: NP_033924
MGI: 88264
Ensembl: ENSMUSG00000026509
Vega: OTTMUSG00000050407
UniProt: O08529
Position
1; 1 H5
AA seq 700 aa
MAGIAIKLAKDREAAEGLGSHERAIKYLNQDYETLRNECLEAGALFQDPSFPALPSSLGY
KELGPYSSKTRGIEWKRPTEICADPQFIIGGATRTDICQGALGDCWLLAAIASLTLNEEI
LARVVPPDQSFQENYAGIFHFQFWQYGEWVEVVVDDRLPTKDGELLFVHSAEGSEFWSAL
LEKAYAKINGCYEALSGGATTEGFEDFTGGIAEWYELRKPPPNLFKIIQKALEKGSLLGC
SIDITSAADSEAVTYQKLVKGHAYSVTGAEEVESSGSLQKLIRIRNPWGQVEWTGKWNDN
CPSWNTVDPEVRANLTERQEDGEFWMSFSDFLRHYSRLEICNLTPDTLTCDSYKKWKLTK
MDGNWRRGSTAGGCRNYPNTFWMNPQYLIKLEEEDEDEEDGERGCTFLVGLIQKHRRRQR
KMGEDMHTIGFGIYEVPEELTGQTNIHLGKNFFLTTRARERSDTFINLREVLNRFKLPPG
EYVLVPSTFEPHKDGDFCIRVFSEKKADYQAVDDEIEANIEEIDANEEDIDDGFRRLFVQ
LAGEDAEISAFELQTILRRVLAKRQDIKSDGFSIETCKIMVDMLDEDGSGKLGLKEFYIL
WTKIQKYQKIYREIDVDRSGTMNSYEMRKALEEAGFKLPCQLHQVIVARFADDELIIDFD
NFVRCLVRLETLFKIFKQLDPENTGTIQLNLASWLSFSVL
NT seq 2103 nt   +upstreamnt  +downstreamnt
atggcgggcatcgcgataaagctggccaaggaccgcgaagcggccgaggggctggggtcg
catgagagagccatcaagtacctcaaccaggactacgagacgctgcggaacgagtgcctg
gaggccggggcgctcttccaggatccttccttccccgccctgccgtcatccttgggctat
aaggagttggggccctactccagcaaaactcggggcatcgaatggaagcggcccacggag
atctgcgctgacccccagttcattattggaggagccacccgcacagacatctgccaagga
gccctgggggactgctggctgctggctgccatcgcctccctcaccttgaatgaggaaatc
ctggctcgggttgtgcctccagatcagagcttccaggaaaactatgcaggcatcttccac
ttccagttctggcaatatggcgagtgggtggaggtggtggtggacgacaggctgcccact
aaggacggggagctgctctttgtgcattcagctgaagggagtgagttctggagtgccctt
ctggagaaagcctatgccaagatcaatgggtgctatgaagcactctcagggggtgccacc
acggaaggctttgaagacttcacaggaggcattgctgagtggtatgagctgaggaagcct
cctcccaacttgttcaagatcatccagaaggctttggagaaaggttctctgcttggctgc
tctatcgatatcaccagcgctgcagattctgaggccgttacgtaccagaagttggtgaaa
ggacatgcgtactctgtcaccggagccgaggaggttgaaagttcaggaagcctgcagaaa
ttgatccgcatcaggaatccctggggacaagtagagtggaccgggaagtggaatgacaat
tgccccagctggaacacggttgacccagaagtaagggcaaatctaaccgaacggcaggag
gacggagaattctggatgtccttcagtgacttcctgagacactactctcgcctggagatc
tgcaacctgaccccggacaccctcacctgtgactcctataagaagtggaaactcaccaag
atggatgggaactggaggcgaggctccaccgcagggggctgcaggaattacccaaatacc
ttctggatgaaccctcagtacctaattaagctggaggaagaagacgaagatgaggaggat
ggggagagaggctgtaccttcctggtgggtctcatccagaagcaccggcgacggcagagg
aagatgggcgaggacatgcacaccattggcttcggcatctatgaggttccagaggagcta
acagggcagaccaacatccacctcggcaaaaactttttcctcacaacccgagccagggag
cggtcagataccttcattaacctccgcgaggtcctcaaccgcttcaagctgcccccggga
gagtatgtcctcgttccctccaccttcgaaccccacaaggatggcgatttctgcatccga
gtcttctcggagaagaaggctgactaccaagctgttgatgacgagatcgaggccaacatt
gaagagattgacgccaatgaggaggacattgacgatggattccgaaggctctttgttcag
ctggctggagaggatgcagagatctctgcctttgagctgcagaccatcttaagaagagtt
ctagccaaacgccaagacatcaagtcagacggcttcagcatcgagacctgtaagatcatg
gtggacatgctggatgaagatgggagtggcaagcttggcctgaaggagttctacatcctc
tggacgaagattcagaaataccaaaaaatctaccgggaaatcgatgtggacaggtctgga
accatgaattcctacgagatgcggaaagcactggaagaagcaggtttcaagctgccctgt
caacttcatcaagtcatcgttgcccggtttgcagacgacgagctaatcatcgactttgac
aattttgtgcggtgtttggtccgtctggaaacgctattcaagatattcaagcagctagac
cctgagaacactggaacgatacagctcaaccttgcttcgtggctgagtttttcagtactc
tga

DBGET integrated database retrieval system