KEGG   Mus musculus (mouse): 12335Help
Entry
12335             CDS       T01002                                 

Gene name
Capn3, AI323605, Capa-3, Capa3, Lp82, p94
Definition
(RefSeq) calpain 3
  KO
K08573  calpain-3 [EC:3.4.22.54]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    12335 (Capn3)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.54  calpain-3
     12335 (Capn3)
Peptidases and inhibitors [BR:mmu01002]
 Cysteine peptidases
  Family C2: calpain family
   12335 (Capn3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C2 Calpain_III Calpain_u2 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_7
Motif
Other DBs
NCBI-GeneID: 12335
NCBI-ProteinID: NP_031627
MGI: 107437
Ensembl: ENSMUSG00000079110
Vega: OTTMUSG00000015381
UniProt: Q64691 Q0VGP9 A4QPE6
Position
2 E5; 2 60.31 cM
AA seq 821 aa AA seqDB search
MPTVISPTVAPRTGAEPRSPGPVPHPAQGKTTEAGGGHPSGIYSAIISRNFPIIGVKEKT
FEQLRRKCLEKKVLYLDPEFPPDETSLFYSQKFPIQFVWKRPPEICENPRFIIGGANRTD
ICQGDLGDCWFLAAIACLTLNERLLFRVIPHDQSFTENYAGIFHFQFWRYGDWVDVVIDD
CLPTYNNQLVFTKSNHRNEFWSALLEKAYAKLHGSYEALKGGNTTEAMEDFTGGVTEFFE
IKDAPSDMYKIMRKAIERGSLMGCSIDDGTNMTYGTSPSGLNMGELIARMVRNMDNSLLR
DSDLDPRGSDDRPSRTIVPVQYETRMACGLVKGHAYSVTGLEEALFKGEKVKLVRLRNPW
GQVEWNGSWSDGWKDWSFVDKDEKARLQHQVTEDGEFWMSYDDFVYHFTKLEICNLTADA
LESDKLQTWTVSVNEGRWVRGCSAGGCRNFPDTFWTNPQYRLKLLEEDDDPEDSEVICSF
LVALMQKNRRKDRKLGANLFTIGFAIYEVPKEMHGNKQHLQKDFFLYNASKARSKTYINM
REVSQRFRLPPSEYVIVPSTYEPHQEGEFILRVFSEKRNLSEEAENTISVDRPVKKKKNK
PIIFVSDRANSNKELGVDQEAEEGKDKAGPEKRGETPQPRPGHTDQESEEQQQFRNIFRQ
IAGDDMEICADELKNVLNTVVNKHKDLKTQGFTLESCRSMIALMDTDGSGRLNLQEFHHL
WKKIKAWQKIFKHYDTDHSGTINSYEMRNAVNDAGFHLNSQLYDIITMRYADKHMNIDFD
SFICCFVRLEGMFRAFNAFDKDGDGIIKLNVLEWLQLTMYA
NT seq 2466 nt NT seq  +upstreamnt  +downstreamnt
atgccaactgttattagtccaactgtggccccaaggacgggggctgagcccaggtcccca
gggccagttcctcacccagctcaaggcaagaccaccgaggctggaggtggacacccaagt
ggcatctattcggccatcattagccgcaattttccgatcatcggtgtgaaagagaagaca
tttgagcagctccgcaggaagtgcctagagaagaaagttctttatctagaccccgagttc
ccaccggatgagacctctctcttttacagtcagaagttccccatccagttcgtctggaag
agacctccggaaatttgtgagaatccccggtttatcattggtggagccaacaggactgac
atctgccaaggagatctaggggactgctggtttcttgcagccatcgcctgcctgaccctg
aatgagcggctgcttttccgagttataccccatgatcaaagtttcactgaaaactacgca
gggatcttccacttccagttctggcgctatggagactgggtagatgtggtcattgacgac
tgtctgccaacatacaacaatcagctggttttcaccaaatccaaccaccgcaatgagttc
tggagtgctctccttgagaaggcttatgccaagctccatggctcctatgaagctctgaaa
ggtgggaataccacagaagccatggaggacttcacaggaggggtgacagagttttttgag
atcaaggatgctccgagtgacatgtacaagattatgaggaaagctatcgagagaggctcc
ctcatgggctgctccattgacgatggcacgaacatgacttatggaacctctccttctggt
ctgaacatgggggagttgattgcacggatggtgagaaatatggataactcgctgctcaga
gactcagacctggaccccaggggctcagatgacagaccgtcacggacaattgttccagtg
cagtatgaaacaagaatggcctgtgggttggtgaaagggcatgcctattcagtcactggg
ctggaggaggccctgttcaaaggtgagaaggtgaagttggtgcggctgcggaacccctgg
ggccaggtggagtggaacggctcttggagtgatggttggaaggactggagctttgtagac
aaagatgagaaggcccgtctacagcaccaggttactgaggatggagagttctggatgtca
tatgatgacttcgtctaccatttcacgaagctggagatctgcaacctcacagctgacgcc
ctggagtccgataagcttcagacctggacggtgtctgtaaacgagggccgctgggtgagg
ggctgttctgctggaggctgccgaaacttcccagacactttctggaccaacccgcagtac
cgtctcaagcttctggaggaagacgatgaccctgaggactctgaggtaatctgcagcttc
ctcgtggctctgatgcagaagaaccggcgcaaggaccggaagctgggggccaacctcttc
actattggcttcgccatctacgaggttcccaaagagatgcacgggaataagcaacacctg
cagaaggacttcttcttgtacaacgcctccaaggccagaagcaaaacctacatcaacatg
cgggaggtgtcccagcgcttccgcctgccacccagcgagtatgtcatcgtaccctccacc
tacgagccccaccaggagggggaattcatcctccgagtcttctccgaaaagaggaatctc
tctgaggaagctgaaaatacaatctctgtggatcggccagtgaaaaagaaaaaaaacaag
cccatcatcttcgtttctgacagagcaaacagcaacaaggagctgggtgtggaccaggag
gcagaggagggcaaagacaaagcagggcccgagaaacgaggggaaaccccacagccaagg
cctggccacacagaccaggaaagtgaggagcagcagcaattccggaacatcttcaggcag
atcgcaggcgacgacatggagatctgtgcagatgaactcaagaatgtcctcaacacagtg
gtgaacaaacacaaggacctgaagacacaagggttcacgctggagtcctgcagaagcatg
atagctctcatggatacagatggctctggaagactgaatcttcaagagttccatcacctc
tggaaaaagatcaaggcctggcagaaaatcttcaagcactatgacacagaccattccggt
accatcaatagctatgagatgcgaaatgcagtcaatgatgcaggcttccatctcaacagc
caactctatgacatcatcaccatgcgctatgcggacaaacacatgaacatcgactttgac
agcttcatctgctgcttcgtcaggctggaagggatgttcagagcttttaacgcatttgac
aaggatggcgatggtatcatcaaactgaatgtacttgagtggctgcagcttaccatgtat
gcctga

DBGET integrated database retrieval system