KEGG   Mus musculus (mouse): 12337
Entry
12337             CDS       T01002                                 

Gene name
Capn5, nCL-3
Definition
(RefSeq) calpain 5
  KO
K08574  calpain-5 [EC:3.4.22.-]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    12337 (Capn5)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     12337 (Capn5)
Peptidases and inhibitors [BR:mmu01002]
 Cysteine peptidases
  Family C2: calpain family
   12337 (Capn5)
SSDB
Motif
Pfam: Peptidase_C2 Calpain_III YkuD
Other DBs
NCBI-GeneID: 12337
NCBI-ProteinID: NP_001288179
MGI: 1100859
Ensembl: ENSMUSG00000035547
Vega: OTTMUSG00000022532
UniProt: O08688 Q3UTF3 Q3TPL4
Position
7; 7 E1
AA seq 640 aa
MFSCAKAYEDQNYSALKRACLRKKVLFEDPLFPATDDSLYYKGTPGPTVRWKRPKDICDD
PRLFVDGISSHDLHQGQVGNCWFVAACSSLASRESLWQKVIPDWKEQEWNPEKPDSYAGI
FHFNFWRFGEWVDVIVDDRLPTVNNQLIYCHSNSKNEFWCALVEKAYAKLAGCYQALDGG
NTADALVDFTGGVSEPIDLTEGDLATDEAKRNQLFERVLKVHSRGGLISASIKAVTAADM
EARLACGLVKGHAYAVTDVRKVRLGHGLLAFFKSEKLDMIRLRNPWGEREWTGPWSDTSE
EWQKVSKSEREKMGVTVQDDGEFWMTFEDMCRYFTDIIKCRLINTSYLSIHKTWEEARLH
GAWTRHEDPQQNRSGGCINHKDTFFQNPQYVFEVKKPEDEVLISIQQRPKRSTRREGKGE
NLAIGFDIYKVEENRQYRMHSLQHKAASSIYINSRSVFLRTELPEGRYVIIPTTFEPGHT
GEFLLRVFTDVPSNCRELRLDEPPRTCWSSLCGYPQQVAQVHVLGAAGLKDSPTGANSYV
IIKCEGEKVRSAVQRGTSTPEYNVKGIFYRKKLAQPITVQVWNHRVLKDEFLGQVHLKTA
PDDLQDLHTLHLQDRSSRQPSDLPGIVAVRVLCSASLTAV
NT seq 1923 nt   +upstreamnt  +downstreamnt
atgttctcctgcgcgaaggcctatgaggaccagaactactcggcgctgaagcgggcctgc
ctgcgcaagaaggtgctgttcgaggatcccctcttccctgccaccgacgactccctttac
tataagggcaccccagggcccacagtcaggtggaagcggcctaaggatatctgcgacgat
ccccggctcttcgtagatggcatcagctcccatgacctgcaccagggccaggtgggcaac
tgctggtttgtggctgcctgctcatcactggcctcccgagagtcactctggcagaaggtc
atcccagactggaaggagcaggaatggaaccccgagaagcctgacagctatgctggcatc
ttccacttcaacttctggcgctttggggagtgggtggacgtaatcgtcgatgaccggctg
cccacagtcaacaaccagctcatttactgccattccaactccaaaaatgagttctggtgt
gccctggtggagaaggcctatgccaagctggccggctgttaccaggccctggacggaggc
aacacggccgatgcattggtggatttcacaggtggtgtttctgaacccattgacctgacc
gagggggacttggccactgacgaggctaagaggaatcagctctttgagcgagtgctgaag
gtgcacagcagaggcgggctcatcagtgcctccatcaaggctgtgacagcagctgacatg
gaggcccgcctggcatgtggcctggtgaagggccatgcatacgctgtcaccgatgtgcgc
aaggtgcgcctgggccatggcctgctggccttcttcaagtcagagaagcttgatatgatc
cgtctgaggaacccctggggcgagcgggagtggacggggccctggagtgacacgtcagag
gaatggcagaaagtgagcaagagtgagagggagaagatgggcgtgaccgtgcaggatgat
ggggaattctggatgacctttgaggacatgtgccggtactttactgacatcattaaatgc
cgcctgattaacacgtcctacctgagcatccataagacatgggaggaggcccggctgcat
ggtgcctggacgagacatgaggacccacagcagaaccgcagtggaggctgcatcaaccac
aaggacactttcttccagaacccacagtacgtatttgaagtcaagaagccagaagatgaa
gtgttgatcagtatccagcagcggccgaagcgctcaactcgccgggagggcaaaggcgag
aatctggccattggcttcgacatctataaggtggaagagaaccgccaataccgtatgcac
agcctacagcataaggccgccagctccatctacatcaattcccgcagcgtttttttgagg
acagagctgcccgagggccgctacgttatcatccctaccacctttgagccaggccacact
ggcgagttcctgctccgagtcttcacagatgtcccctccaactgccgggaactacgcctg
gatgagccccctcggacctgttggagttccctctgtggctaccctcagcaggtggcccag
gtacatgtcctgggggctgctggcctcaaggactccccaacaggagcaaactcatatgtg
atcatcaagtgtgagggcgaaaaggttcgctcagctgtgcagagagggacctcgacacca
gagtacaatgtaaaaggcatcttctatcgcaagaagctggctcagcctatcaccgtgcag
gtttggaatcaccgagtcctgaaggatgaattcctgggccaggtgcacctgaagactgcc
ccggatgacctgcaggacctccacaccctccatctccaggaccgcagtagccggcagccc
agtgacctgccaggcattgtagctgtgcgagtcctctgcagtgcctctctcacggctgtc
tga

DBGET integrated database retrieval system