KEGG   Mus musculus (mouse): 12346Help
Entry
12346             CDS       T01002                                 

Gene name
Car1, AW555628, Ca1, Car-1
Definition
(RefSeq) carbonic anhydrase 1
  KO
K01672  carbonic anhydrase [EC:4.2.1.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00910  Nitrogen metabolism
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    12346 (Car1)
Enzymes [BR:mmu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.1  carbonic anhydrase
     12346 (Car1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carb_anhydrase
Motif
Other DBs
NCBI-GeneID: 12346
NCBI-ProteinID: NP_001077426
MGI: 88268
Ensembl: ENSMUSG00000027556
Vega: OTTMUSG00000026455
UniProt: P13634
Position
3 A1; 3 3.18 cM
AA seq 261 aa AA seqDB search
MASADWGYGSENGPDQWSKLYPIANGNNQSPIDIKTSEANHDSSLKPLSISYNPATAKEI
VNVGHSFHVIFDDSSNQSVLKGGPLADSYRLTQFHFHWGNSNDHGSEHTVDGTRYSGELH
LVHWNSAKYSSASEAISKADGLAILGVLMKVGPANPSLQKVLDALNSVKTKGKRAPFTNF
DPSSLLPSSLDYWTYFGSLTHPPLHESVTWVICKDSISLSPEQLAQLRGLLSSAEGEPAV
PVLSNHRPPQPLKGRTVRASF
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggcaagtgcagactggggatatggaagcgaaaatggtcctgaccaatggagcaagctg
tatcccattgccaatggaaacaaccagtctcctattgatattaaaaccagtgaagccaat
catgactcctctctgaaaccactcagcatctcctataatcctgcaactgccaaagaaatt
gttaacgtgggacattctttccatgtaatttttgatgacagtagcaaccaatctgttctg
aaaggtggccctcttgctgatagctatcggctcactcagttccattttcactggggcaac
tcaaacgaccatggctctgagcacaccgtggatggaactagatattctggagagcttcac
ttagttcactggaattctgcaaagtactccagtgcttctgaagccatctccaaggctgat
ggcctggcaatccttggcgttttgatgaaggttggtccagccaacccaagcctgcagaaa
gtacttgatgctctaaactcagttaaaactaagggaaaacgagccccattcacaaatttt
gacccatccagtctgcttccttcatctctggattactggacctactttggctctctgact
caccctcctcttcatgaaagtgtgacctgggtgatctgcaaggatagcatcagtctaagc
ccagagcagctggcccagctccgtggtcttctgtcaagtgcagagggagagcctgcagtt
ccagttctgagcaaccaccgtccaccccaacccctgaagggcagaacagtcagagcctca
ttttga

DBGET integrated database retrieval system