KEGG   Mus musculus (mouse): 12354
Entry
12354             CDS       T01002                                 

Gene name
Car7, AV343731, Ca7
Definition
(RefSeq) carbonic anhydrase 7
  KO
K01672  carbonic anhydrase [EC:4.2.1.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00910  Nitrogen metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    12354 (Car7)
Enzymes [BR:mmu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.1  carbonic anhydrase
     12354 (Car7)
SSDB
Motif
Pfam: Carb_anhydrase DUF2415
Other DBs
NCBI-GeneID: 12354
NCBI-ProteinID: NP_444300
MGI: 103100
Ensembl: ENSMUSG00000031883
Vega: OTTMUSG00000029166
UniProt: Q9ERQ8
Position
8; 8 D3
AA seq 264 aa
MTGHHCWGYGQDDGPSNWHKLYPIAQGDRQSPINIISSQAVYSPSLQPLELFYEACMSLS
ITNNGHSVQVDFNDSDDRTVVSGGPLEGPYRLKQLHFHWGKKRDMGSEHTVDGKSFPSEL
HLVHWNAKKYSTFGEAAAAPDGLAVVGVFLETGDEHPSMNRLTDALYMVRFKDTKAQFSC
FNPKCLLPTSRHYWTYPGSLTTPPLSESVTWIVLREPIRISERQMEKFRSLLFTSEDDER
IHMVDNFRPPQPLKGRVVKASFQA
NT seq 795 nt   +upstreamnt  +downstreamnt
atgaccggccaccactgttggggctacggccaggacgacggcccttcaaattggcacaag
ctgtatcccattgcccagggagaccgccagtcacccatcaatatcatatccagccaggct
gtgtactcgcccagcctgcagccactggaacttttctatgaggcctgcatgtccctcagc
atcaccaacaatggccactctgtccaggtggacttcaatgacagtgatgacagaaccgtg
gtgtctgggggccccctggaagggccctatcgtctcaagcagctccacttccactggggc
aagaagcgcgacatgggctcagagcacacagtggacggcaagtccttccccagcgagcta
catctggttcactggaacgccaagaagtacagcacttttggggaggcggctgcagcccct
gatggcctggctgtggttggtgtcttcctggagacaggagatgagcacccaagcatgaac
cgcctgacagacgccctctacatggttcgatttaaggacaccaaggcccagttcagctgc
ttcaaccccaagtgcctgctgcccaccagccgacactactggacctatcctggctccctg
accacacccccactcagtgagagtgtcacttggattgtgcttcgggagcccatcaggatc
tccgagaggcagatggagaaattccggagcctgcttttcacctcagaggatgatgagagg
atccatatggtggacaacttccggccaccacagccgctgaagggccgagtggtcaaagca
tccttccaggcctga

DBGET integrated database retrieval system