KEGG   Mus musculus (mouse): 12359
Entry
12359             CDS       T01002                                 

Gene name
Cat, 2210418N07, Ca, Cas, Cas-1, Cas1, Cs-, Cs-1
Definition
(RefSeq) catalase
  KO
K03781  catalase [EC:1.11.1.6]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00380  Tryptophan metabolism
mmu00630  Glyoxylate and dicarboxylate metabolism
mmu01100  Metabolic pathways
mmu01200  Carbon metabolism
mmu04068  FoxO signaling pathway
mmu04146  Peroxisome
mmu04211  Longevity regulating pathway
mmu04213  Longevity regulating pathway - multiple species
mmu05014  Amyotrophic lateral sclerosis
mmu05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    12359 (Cat)
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    12359 (Cat)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    12359 (Cat)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    12359 (Cat)
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway
    12359 (Cat)
   04213 Longevity regulating pathway - multiple species
    12359 (Cat)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    12359 (Cat)
   05022 Pathways of neurodegeneration - multiple diseases
    12359 (Cat)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     12359 (Cat)
SSDB
Motif
Pfam: Catalase Catalase-rel
Other DBs
NCBI-GeneID: 12359
NCBI-ProteinID: NP_033934
MGI: 88271
Ensembl: ENSMUSG00000027187
Vega: OTTMUSG00000014875
UniProt: P24270
Position
2 E2; 2 54.43 cM
AA seq 527 aa
MSDSRDPASDQMKQWKEQRASQRPDVLTTGGGNPIGDKLNIMTAGSRGPLLVQDVVFTDE
MAHFDRERIPERVVHAKGAGAFGYFEVTHDITRYSKAKVFEHIGKRTPIAVRFSTVTGES
GSADTVRDPRGFAVKFYTEDGNWDLVGNNTPIFFIRDAILFPSFIHSQKRNPQTHLKDPD
MVWDFWSLRPESLHQVSFLFSDRGIPDGHRHMNGYGSHTFKLVNADGEAVYCKFHYKTDQ
GIKNLPVGEAGRLAQEDPDYGLRDLFNAIANGNYPSWTFYIQVMTFKEAETFPFNPFDLT
KVWPHKDYPLIPVGKLVLNKNPVNYFAEVEQMAFDPSNMPPGIEPSPDKMLQGRLFAYPD
THRHRLGPNYLQIPVNCPYRARVANYQRDGPMCMHDNQGGAPNYYPNSFSAPEQQRSALE
HSVQCAVDVKRFNSANEDNVTQVRTFYTKVLNEEERKRLCENIAGHLKDAQLFIQKKAVK
NFTDVHPDYGARIQALLDKYNAEKPKNAIHTYTQAGSHMAAKGKANL
NT seq 1584 nt   +upstreamnt  +downstreamnt
atgtcggacagtcgggacccagccagcgaccagatgaagcagtggaaggagcagcgggcc
tcgcagagacctgatgtcctgaccaccggaggcgggaacccaataggagataaacttaat
atcatgaccgcggggtcccgagggcccctcctcgttcaggatgtggttttcactgacgag
atggcacactttgacagagagcggattcctgagagagtggtacacgcaaaaggagcaggt
gcttttggatactttgaggtcacccacgatatcaccagatactccaaggcaaaggtgttt
gagcatattggaaagaggacccctattgccgttcgattctccacagtcactggagagtca
ggctcagctgacacagttcgtgaccctcgggggtttgcagtgaaattttacactgaagat
ggtaactgggatcttgtgggaaacaacacccctattttcttcatcagggatgccatattg
tttccatcctttatccatagccagaagagaaacccacagactcacctgaaggatcctgac
atggtctgggacttctggagtcttcgtcccgagtctctccatcaggtttctttcttgttc
agtgaccgagggattcccgatggtcaccggcacatgaatggctatggatcacacaccttc
aagttggttaatgcagatggagaggcagtctattgcaagttccattacaagaccgaccag
ggcatcaaaaacttgcctgttggagaggcaggaaggcttgctcaggaagatccggattat
ggcctccgagatcttttcaatgccatcgccaatggcaattacccgtcctggacgttttac
atccaggtcatgacttttaaggaggcagaaactttcccatttaatccatttgatctgacc
aaggtttggcctcacaaggactaccctcttataccagttggcaaactggttttaaacaaa
aatccagttaattactttgctgaagttgaacagatggcttttgacccaagcaatatgccc
cctggcatcgagcccagccctgacaaaatgcttcagggccgcctttttgcctacccggac
actcaccgccaccgcctgggacccaactatctgcagatacctgtgaactgtccctaccgc
gctcgagtggccaactaccagcgtgatggccccatgtgcatgcatgacaaccagggtggt
gcccccaactattaccccaacagcttcagcgcaccagagcagcagcgctcagccctggag
cacagcgtccagtgcgctgtagatgtgaaacgcttcaacagtgctaatgaagacaatgtc
actcaggtgcggacattctacacaaaggtgttgaacgaggaggagaggaaacgcctgtgt
gagaacattgccggccacctgaaggacgctcagcttttcattcagaagaaagcggtcaag
aatttcactgacgtccaccctgactatggggcccgcatccaggctcttctggacaagtac
aacgctgagaagcctaagaacgcaattcacacctacacgcaggccggctctcacatggct
gcgaagggaaaagctaacctgtaa

DBGET integrated database retrieval system