KEGG   Mus musculus (mouse): 12362Help
Entry
12362             CDS       T01002                                 

Gene name
Casp1, ICE, Il1bc
Definition
(RefSeq) caspase 1
  KO
K01370  caspase 1 [EC:3.4.22.36]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04217  Necroptosis
mmu04621  NOD-like receptor signaling pathway
mmu04623  Cytosolic DNA-sensing pathway
mmu04625  C-type lectin receptor signaling pathway
mmu05014  Amyotrophic lateral sclerosis (ALS)
mmu05132  Salmonella infection
mmu05133  Pertussis
mmu05134  Legionellosis
mmu05164  Influenza A
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    12362 (Casp1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    12362 (Casp1)
   04623 Cytosolic DNA-sensing pathway
    12362 (Casp1)
   04625 C-type lectin receptor signaling pathway
    12362 (Casp1)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    12362 (Casp1)
  09171 Infectious diseases: Bacterial
   05132 Salmonella infection
    12362 (Casp1)
   05133 Pertussis
    12362 (Casp1)
   05134 Legionellosis
    12362 (Casp1)
  09172 Infectious diseases: Viral
   05164 Influenza A
    12362 (Casp1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:mmu01002]
    12362 (Casp1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    12362 (Casp1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.36  caspase-1
     12362 (Casp1)
Peptidases [BR:mmu01002]
 Cysteine Peptidases
  Family C14: caspase family
   12362 (Casp1)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Other autophagy associated proteins
   TRIM-directed selective autophagy
    12362 (Casp1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C14 CARD
Motif
Other DBs
NCBI-GeneID: 12362
NCBI-ProteinID: NP_033937
MGI: 96544
Ensembl: ENSMUSG00000025888
UniProt: P29452
Position
9 A1; 9 2.46 cM
AA seq 402 aa AA seqDB search
MADKILRAKRKQFINSVSIGTINGLLDELLEKRVLNQEEMDKIKLANITAMDKARDLCDH
VSKKGPQASQIFITYICNEDCYLAGILELQSAPSAETFVATEDSKGGHPSSSETKEEQNK
EDGTFPGLTGTLKFCPLEKAQKLWKENPSEIYPIMNTTTRTRLALIICNTEFQHLSPRVG
AQVDLREMKLLLEDLGYTVKVKENLTALEMVKEVKEFAACPEHKTSDSTFLVFMSHGIQE
GICGTTYSNEVSDILKVDTIFQMMNTLKCPSLKDKPKVIIIQACRGEKQGVVLLKDSVRD
SEEDFLTDAIFEDDGIKKAHIEKDFIAFCSSTPDNVSWRHPVRGSLFIESLIKHMKEYAW
SCDLEDIFRKVRFSFEQPEFRLQMPTADRVTLTKRFYLFPGH
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggctgacaagatcctgagggcaaagaggaagcaatttatcaactcagtgagtataggg
acaataaatggattgttggatgaacttttagagaagagagtgctgaatcaggaagaaatg
gataaaataaaacttgcaaacattactgctatggacaaggcacgggacctatgtgatcat
gtctctaaaaaagggccccaggcaagccaaatctttatcacttacatttgtaatgaagac
tgctacctggcaggaattctggagcttcaatcagctccatcagctgaaacatttgttgct
acagaagattctaaaggaggacatccttcatcctcagaaacaaaggaagaacagaacaaa
gaagatggcacatttccaggactgactgggaccctcaagttttgccctttagaaaaagcc
cagaagttatggaaagaaaatccttcagagatttatccaataatgaatacaaccactcgt
acacgtcttgccctcattatctgcaacacagagtttcaacatctttctccgagggttgga
gctcaagttgacctcagagaaatgaagttgctgctggaggatctggggtataccgtgaaa
gtgaaagaaaatctcacagctctggagatggtgaaagaggtgaaagaatttgctgcctgc
ccagagcacaagacttctgacagtactttccttgtattcatgtctcatggtatccaggag
ggaatatgtgggaccacatactctaatgaagtttcagatattttaaaggttgacacaatc
tttcagatgatgaacactttgaagtgcccaagcttgaaagacaagcccaaggtgatcatt
attcaggcatgccgtggagagaaacaaggagtggtgttgttaaaagattcagtaagagac
tctgaagaggatttcttaacggatgcaatttttgaagatgatggcattaagaaggcccat
atagagaaagattttattgctttctgctcttcaacaccagataatgtgtcttggagacat
cctgtcaggggctcacttttcattgagtcactcatcaaacacatgaaagaatatgcctgg
tcttgtgacttggaggacattttcagaaaggttcgattttcatttgaacaaccagaattt
aggctacagatgcccactgctgatagggtgaccctgacaaaacgtttctacctcttcccg
ggacattaa

DBGET integrated database retrieval system