KEGG   Mus musculus (mouse): 12362
Entry
12362             CDS       T01002                                 

Gene name
Casp1, Casp, IC, ICE, Il1, Il1bc
Definition
(RefSeq) caspase 1
  KO
K01370  caspase 1 [EC:3.4.22.36]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04217  Necroptosis
mmu04613  Neutrophil extracellular trap formation
mmu04621  NOD-like receptor signaling pathway
mmu04623  Cytosolic DNA-sensing pathway
mmu04625  C-type lectin receptor signaling pathway
mmu05014  Amyotrophic lateral sclerosis
mmu05132  Salmonella infection
mmu05133  Pertussis
mmu05134  Legionellosis
mmu05135  Yersinia infection
mmu05164  Influenza A
mmu05171  Coronavirus disease - COVID-19
mmu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    12362 (Casp1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    12362 (Casp1)
   04621 NOD-like receptor signaling pathway
    12362 (Casp1)
   04623 Cytosolic DNA-sensing pathway
    12362 (Casp1)
   04625 C-type lectin receptor signaling pathway
    12362 (Casp1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    12362 (Casp1)
   05164 Influenza A
    12362 (Casp1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    12362 (Casp1)
   05135 Yersinia infection
    12362 (Casp1)
   05133 Pertussis
    12362 (Casp1)
   05134 Legionellosis
    12362 (Casp1)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    12362 (Casp1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    12362 (Casp1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    12362 (Casp1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    12362 (Casp1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.36  caspase-1
     12362 (Casp1)
Peptidases and inhibitors [BR:mmu01002]
 Cysteine peptidases
  Family C14: caspase family
   12362 (Casp1)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Other autophagy associated proteins
   TRIM-directed selective autophagy
    12362 (Casp1)
SSDB
Motif
Pfam: Peptidase_C14 CARD
Other DBs
NCBI-GeneID: 12362
NCBI-ProteinID: NP_033937
MGI: 96544
Ensembl: ENSMUSG00000025888
UniProt: P29452
Position
9 A1; 9 2.46 cM
AA seq 402 aa
MADKILRAKRKQFINSVSIGTINGLLDELLEKRVLNQEEMDKIKLANITAMDKARDLCDH
VSKKGPQASQIFITYICNEDCYLAGILELQSAPSAETFVATEDSKGGHPSSSETKEEQNK
EDGTFPGLTGTLKFCPLEKAQKLWKENPSEIYPIMNTTTRTRLALIICNTEFQHLSPRVG
AQVDLREMKLLLEDLGYTVKVKENLTALEMVKEVKEFAACPEHKTSDSTFLVFMSHGIQE
GICGTTYSNEVSDILKVDTIFQMMNTLKCPSLKDKPKVIIIQACRGEKQGVVLLKDSVRD
SEEDFLTDAIFEDDGIKKAHIEKDFIAFCSSTPDNVSWRHPVRGSLFIESLIKHMKEYAW
SCDLEDIFRKVRFSFEQPEFRLQMPTADRVTLTKRFYLFPGH
NT seq 1209 nt   +upstreamnt  +downstreamnt
atggctgacaagatcctgagggcaaagaggaagcaatttatcaactcagtgagtataggg
acaataaatggattgttggatgaacttttagagaagagagtgctgaatcaggaagaaatg
gataaaataaaacttgcaaacattactgctatggacaaggcacgggacctatgtgatcat
gtctctaaaaaagggccccaggcaagccaaatctttatcacttacatttgtaatgaagac
tgctacctggcaggaattctggagcttcaatcagctccatcagctgaaacatttgttgct
acagaagattctaaaggaggacatccttcatcctcagaaacaaaggaagaacagaacaaa
gaagatggcacatttccaggactgactgggaccctcaagttttgccctttagaaaaagcc
cagaagttatggaaagaaaatccttcagagatttatccaataatgaatacaaccactcgt
acacgtcttgccctcattatctgcaacacagagtttcaacatctttctccgagggttgga
gctcaagttgacctcagagaaatgaagttgctgctggaggatctggggtataccgtgaaa
gtgaaagaaaatctcacagctctggagatggtgaaagaggtgaaagaatttgctgcctgc
ccagagcacaagacttctgacagtactttccttgtattcatgtctcatggtatccaggag
ggaatatgtgggaccacatactctaatgaagtttcagatattttaaaggttgacacaatc
tttcagatgatgaacactttgaagtgcccaagcttgaaagacaagcccaaggtgatcatt
attcaggcatgccgtggagagaaacaaggagtggtgttgttaaaagattcagtaagagac
tctgaagaggatttcttaacggatgcaatttttgaagatgatggcattaagaaggcccat
atagagaaagattttattgctttctgctcttcaacaccagataatgtgtcttggagacat
cctgtcaggggctcacttttcattgagtcactcatcaaacacatgaaagaatatgcctgg
tcttgtgacttggaggacattttcagaaaggttcgattttcatttgaacaaccagaattt
aggctacagatgcccactgctgatagggtgaccctgacaaaacgtttctacctcttcccg
ggacattaa

DBGET integrated database retrieval system