KEGG   Mus musculus (mouse): 12363Help
Entry
12363             CDS       T01002                                 

Gene name
Casp4, CASP-11, CASP-4, Casp11, Caspl, ich-3
Definition
(RefSeq) caspase 4, apoptosis-related cysteine peptidase
  KO
K04394  caspase 4 [EC:3.4.22.57 3.4.22.64]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04621  NOD-like receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    12363 (Casp4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:mmu01002]
    12363 (Casp4)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.57  caspase-4
     12363 (Casp4)
    3.4.22.64  caspase-11
     12363 (Casp4)
Peptidases [BR:mmu01002]
 Cysteine Peptidases
  Family C14: caspase family
   12363 (Casp4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C14 CARD
Motif
Other DBs
NCBI-GeneID: 12363
NCBI-ProteinID: NP_031635
MGI: 107700
Ensembl: ENSMUSG00000033538
Vega: OTTMUSG00000033830
UniProt: P70343
Position
9 A1; 9 2.46 cM
AA seq 373 aa AA seqDB search
MAENKHPDKPLKVLEQLGKEVLTEYLEKLVQSNVLKLKEEDKQKFNNAERSDKRWVFVDA
MKKKHSKVGEMLLQTFFSVDPGSHHGEANLEMEEPEESLNTLKLCSPEEFTRLCREKTQE
IYPIKEANGRTRKALIICNTEFKHLSLRYGANFDIIGMKGLLEDLGYDVVVKEELTAEGM
ESEMKDFAALSEHQTSDSTFLVLMSHGTLHGICGTMHSEKTPDVLQYDTIYQIFNNCHCP
GLRDKPKVIIVQACRGGNSGEMWIRESSKPQLCRGVDLPRNMEADAVKLSHVEKDFIAFY
STTPHHLSYRDKTGGSYFITRLISCFRKHACSCHLFDIFLKVQQSFEKASIHSQMPTIDR
ATLTRYFYLFPGN
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaaacaaacaccctgacaaaccacttaaggtgttggaacagctgggcaaagaa
gtccttacggagtacctagaaaaattagtacaaagcaatgtactgaaattaaaggaggaa
gataaacaaaaatttaacaatgctgaacgcagtgacaagcgttgggtttttgtagatgcc
atgaaaaagaaacacagcaaagtaggtgaaatgcttctccagacattcttcagtgtggac
ccaggcagccaccatggtgaagctaatctggaaatggaggaaccagaagaatcattgaac
actctcaagctttgttcccctgaagagttcacaaggctttgcagagaaaagacacaagaa
atttacccaataaaggaggccaatggccgtacacgaaaggctcttatcatatgcaataca
gagttcaaacatctctcactgaggtatggggctaactttgacatcattggtatgaaaggc
cttcttgaagacttaggctacgatgtggtggtgaaagaggagcttacagcagagggcatg
gagtcagagatgaaagactttgctgcactctcagaacaccagacatcagacagcacattc
ctggtgctaatgtctcatggcacactgcatggcatttgtggaacaatgcacagtgaaaaa
actccagatgtgctacagtatgataccatctatcagatattcaacaattgccactgtcca
ggtctacgagacaaacccaaagtcatcattgtgcaggcctgcagaggtgggaactctgga
gaaatgtggatcagagagtcttcaaaaccccagttgtgcagaggtgtagatctacctagg
aatatggaagctgatgctgtcaagctgagccacgtggagaaggacttcattgccttctac
tctacaaccccacatcacttgtcctaccgagacaaaacaggaggctcttacttcatcact
agactcatttcctgcttccggaaacatgcttgctcttgtcatctctttgatatattcctg
aaggtgcaacaatcatttgaaaaggcaagtattcattcccagatgcccaccattgatcgg
gcaaccttgacgagatatttctacctctttcctggcaactga

DBGET integrated database retrieval system