KEGG   Mus musculus (mouse): 12364
Entry
12364             CDS       T01002                                 

Gene name
Casp12
Definition
(RefSeq) caspase 12
  KO
K04741  caspase 12 [EC:3.4.22.-]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
mmu04210  Apoptosis
mmu04621  NOD-like receptor signaling pathway
mmu05010  Alzheimer disease
mmu05014  Amyotrophic lateral sclerosis
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05161  Hepatitis B
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    12364 (Casp12)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    12364 (Casp12)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    12364 (Casp12)
 09160 Human Diseases
  09172 Infectious disease: viral
   05161 Hepatitis B
    12364 (Casp12)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    12364 (Casp12)
   05014 Amyotrophic lateral sclerosis
    12364 (Casp12)
   05020 Prion disease
    12364 (Casp12)
   05022 Pathways of neurodegeneration - multiple diseases
    12364 (Casp12)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    12364 (Casp12)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-  
     12364 (Casp12)
Peptidases and inhibitors [BR:mmu01002]
 Cysteine peptidases
  Family C14: caspase family
   12364 (Casp12)
SSDB
Motif
Pfam: Peptidase_C14 CARD HP0268
Other DBs
NCBI-GeneID: 12364
NCBI-ProteinID: NP_033938
MGI: 1312922
Ensembl: ENSMUSG00000025887
Vega: OTTMUSG00000033710
UniProt: O08736
Position
9 A1; 9 2.46 cM
AA seq 419 aa
MAARRTHERDPIYKIKGLAKDMLDGVFDDLVEKNVLNGDELLKIGESASFILNKAENLVE
NFLEKTDMAGKIFAGHIANSQEQLSLQFSNDEDDGPQKICTPSSPSESKRKVEDDEMEVN
AGLAHESHLMLTAPHGLQSSEVQDTLKLCPRDQFCKIKTERAKEIYPVMEKEGRTRLALI
ICNKKFDYLFDRDNADTDILNMQELLENLGYSVVLKENLTAQEMETELMQFAGRPEHQSS
DSTFLVFMSHGILEGICGVKHRNKKPDVLHDDTIFKIFNNSNCRSLRNKPKILIMQACRG
RYNGTIWVSTNKGIATADTDEERVLSCKWNNSITKAHVETDFIAFKSSTPHNISWKVGKT
GSLFISKLIDCFKKYCWCYHLEEIFRKVQHSFEVPGELTQMPTIERVSMTRYFYLFPGN
NT seq 1260 nt   +upstreamnt  +downstreamnt
atggcggccaggaggacacatgaaagagatccaatctacaagatcaaaggtttggccaag
gacatgctggatggggtttttgatgacctggtggagaagaatgttttaaatggagatgag
ttactcaaaataggggaaagtgcgagtttcatcctgaacaaggctgagaatctggttgag
aacttcttagagaaaacagacatggcaggaaaaatatttgctggccacattgccaattcc
caggaacagctgagtttacaattttctaatgatgaggatgatggacctcagaagatatgt
acaccttcttctccatcagaatccaagagaaaagtagaggatgatgaaatggaggtaaat
gctggattggcccatgaatcacatctaatgctgacagctcctcatggactccagagctca
gaagtccaagatacactgaagctttgtccacgtgatcagttttgtaagataaagacagaa
agggcaaaagagatatatccagtgatggagaaggagggacgaacacgtctggctctcatc
atctgcaacaaaaagtttgactacctttttgatagagataatgctgatactgacattttg
aacatgcaagaactacttgaaaatcttggatactctgtggtgttaaaggaaaaccttaca
gctcaggaaatggagacagagttaatgcagtttgctggccgtccagagcaccagtcctca
gacagcacattcctggtgtttatgtcccatggcatcctggaaggaatctgtggggtgaag
caccgaaacaaaaagccagatgttcttcatgatgacactatcttcaaaattttcaacaac
tctaactgtcggagtctgagaaacaaacccaagattctcatcatgcaggcctgcagaggc
agatataatggaactatttgggtatccacaaacaaagggatagccactgctgatacagat
gaggaacgtgtgttgagctgtaaatggaataatagtataacaaaggcccatgtggagaca
gatttcattgctttcaaatcttctaccccacataatatttcttggaaggtaggcaagact
ggttccctcttcatttccaaactcattgactgcttcaaaaagtactgttggtgttatcat
ttggaggaaatttttcgaaaggttcaacactcatttgaggtcccaggtgaactgacccag
atgcccactattgagagagtatccatgacacgctatttctacctttttcccgggaattag

DBGET integrated database retrieval system