KEGG   Mus musculus (mouse): 12369
Entry
12369             CDS       T01002                                 

Gene name
Casp7, AI314680, CMH-1, ICE-, ICE-IAP3, Mch3, casp, caspase-7, mCASP-7
Definition
(RefSeq) caspase 7
  KO
K04397  caspase 7 [EC:3.4.22.60]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04210  Apoptosis
mmu04215  Apoptosis - multiple species
mmu04668  TNF signaling pathway
mmu04932  Non-alcoholic fatty liver disease
mmu05010  Alzheimer disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05132  Salmonella infection
mmu05133  Pertussis
mmu05134  Legionellosis
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    12369 (Casp7)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    12369 (Casp7)
   04215 Apoptosis - multiple species
    12369 (Casp7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    12369 (Casp7)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    12369 (Casp7)
   05133 Pertussis
    12369 (Casp7)
   05134 Legionellosis
    12369 (Casp7)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    12369 (Casp7)
   05022 Pathways of neurodegeneration - multiple diseases
    12369 (Casp7)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    12369 (Casp7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    12369 (Casp7)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.60  caspase-7
     12369 (Casp7)
Peptidases and inhibitors [BR:mmu01002]
 Cysteine peptidases
  Family C14: caspase family
   12369 (Casp7)
SSDB
Motif
Pfam: Peptidase_C14
Other DBs
NCBI-GeneID: 12369
NCBI-ProteinID: NP_031637
MGI: 109383
Ensembl: ENSMUSG00000025076
UniProt: P97864 Q4FJQ4
Position
19 D2; 19 51.84 cM
AA seq 303 aa
MTDDQDCAAELEKVDSSSEDGVDAKPDRSSIISSILLKKKRNASAGPVRTGRDRVPTYLY
RMDFQKMGKCIIINNKNFDKATGMDVRNGTDKDAGALFKCFQNLGFEVTVHNDCSCAKMQ
DLLRKASEEDHSNSACFACVLLSHGEEDLIYGKDGVTPIKDLTAHFRGDRCKTLLEKPKL
FFIQACRGTELDDGIQADSGPINDIDANPRNKIPVEADFLFAYSTVPGYYSWRNPGKGSW
FVQALCSILNEHGKDLEIMQILTRVNDRVARHFESQSDDPRFNEKKQIPCMVSMLTKELY
FSR
NT seq 912 nt   +upstreamnt  +downstreamnt
atgaccgatgatcaggactgtgctgcggagctggaaaaggtggattcttccagcgaagac
ggagttgacgccaagccagaccgctcctctatcatctcctctattctcttgaagaagaag
agaaatgcctctgcgggccccgtcaggaccggccgggaccgagtgcccacttatctgtac
cgcatggatttccagaagatgggtaaatgcatcatcataaacaacaagaacttcgacaaa
gcgacaggtatggacgtccggaatgggacggacaaagatgcaggggccctcttcaagtgc
ttccaaaacctgggttttgaagtaaccgtccacaatgactgctcttgtgcaaagatgcaa
gatctgcttagaaaagcctctgaggaggaccacagcaactcggcctgcttcgcctgcgtc
ctgctgagccacggggaagaggacctgatttacgggaaagatggcgtgacacccataaag
gatctgacagctcattttaggggagaccgatgcaaaaccctgttagagaaacccaaactc
ttcttcattcaggcatgccgagggacggagctcgatgatggaatccaggctgactcgggg
cccatcaacgacattgacgctaatccccgcaacaagatcccggtggaagccgacttcctc
tttgcttactccacggttccaggttattactcatggaggaacccagggaaaggctcctgg
tttgtgcaggccctctgctccatcctgaatgagcatggcaaggacctcgagatcatgcag
atcctgaccagggtgaacgacagggtggccaggcacttcgagtcccagtctgatgatcca
cgcttcaacgagaagaagcagatcccgtgtatggtgtccatgctcaccaaagagctgtac
ttcagccgttga

DBGET integrated database retrieval system